A0A0R0E484 · A0A0R0E484_SOYBN
- ProteinLeucine-rich repeat-containing N-terminal plant-type domain-containing protein
- Gene100817086
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids932 (go to sequence)
- Protein existencePredicted
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane |
Names & Taxonomy
Protein names
- Recommended nameLeucine-rich repeat-containing N-terminal plant-type domain-containing protein
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > indigoferoid/millettioid clade > Phaseoleae > Glycine > Glycine subgen. Soja
Accessions
- Primary accessionA0A0R0E484
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 877-898 | Helical | ||||
Sequence: FYIGMGVEFAAGFWGFCSVVFF |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MAVLYATHVLLLILSTATT | ||||||
Chain | PRO_5014520698 | 20-932 | Leucine-rich repeat-containing N-terminal plant-type domain-containing protein | |||
Sequence: LHFSASKAARLNMTCSEKERNALLSFKHGLADPSNRLSSWSDKSDCCTWPGVHCNNTGKVMEINLDTPAGSPYRELSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSGFMGLIPHQLGNLSNLQHLNLGYNYALQIDNLNWISRLSSLEYLDLSGSDLHKQGNWLQVLSALPSLSELHLESCQIDNLGPPKRKANFTHLQVLDLSINNLNHQIPSWLFNLSTTLVQLDLHSNLLQGQIPQIISSLQNIKNLDLQNNQLSGPLPDSLGQLKHLEVLNLSNNTFTCPIPSPFANLSSLRTLNLAHNRLNGTIPKSFEFLRNLQVLNLGTNSLTGDMPVTLGTLSNLVMLDLSSNLLEGSIKESNFVKLLKLKELRLSWTNLFLSVNSGWVPPFQLEYVLLSSFGIGPKFPEWLKRQSSVKVLTMSKAGIADLVPSWFWNWTSQIEFLDLSNNLLSGDLSNIFLNCSVINLSSNLFKGTLPSVSANVEVLNVANNSISGTISPFLCGKENATNKLSVLDFSNNVLYGDLGHCWVHWQALVHLNLGSNNLSGVIPNSMGYLSQLESLLLDDNRFSGYIPSTLQNCSTMKFIDMGNNQLSDAIPDWMWEMQYLMVLRLRSNNFNGSITEKICQLSSLIVLDLGNNSLSGSIPNCLDDMKTMAGEDDFFANPLSYSYGSDFSYNHYKETLVLVPKGDELEYRDNLILVRMIDLSSNKLSGAIPSEISKLSALRFLNLSRNHLSGGIPNDMGKMKLLESLDLSLNNISGQIPQSLSDLSFLSVLNLSYNNLSGRIPTSTQLQSFEELSYTGNPELCGPPVTKNCTDKEELTESASVGHGDGNFFGTSEFYIGMGVEFAAGFWGFCSVVFFNRTWRRAYFHYLDHLRDLIYVIIVLKVRRLLGKL |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 37-74 | Leucine-rich repeat-containing N-terminal plant-type | ||||
Sequence: KERNALLSFKHGLADPSNRLSSWSDKSDCCTWPGVHCN |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length932
- Mass (Da)103,588
- Last updated2016-01-20 v1
- ChecksumF1958613D29D266B
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KZ847210 EMBL· GenBank· DDBJ | KRG88581.1 EMBL· GenBank· DDBJ | Genomic DNA |