A0A097NUC1 · A0A097NUC1_9ASTR
- Protein60S ribosomal export protein NMD3
- GeneNMD3L
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids476 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Acts as an adapter for the XPO1/CRM1-mediated export of the 60S ribosomal subunit.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | ribosomal large subunit binding | |
Biological Process | protein transport | |
Biological Process | ribosomal large subunit export from nucleus |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended name60S ribosomal export protein NMD3
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > campanulids > Asterales > Asteraceae > Cichorioideae > Cichorieae > Crepidinae > Taraxacum
Accessions
- Primary accessionA0A097NUC1
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 19-248 | Nmd3 N-terminal | ||||
Sequence: CCKCGIPMPPNAANMCVKCLRSEVDITEGLQKHVIIIHCPECDTYLQPPRTWLKAQLESKELLTFCVKRLKNLNKVRLIHAEFIWTEPHSKRLKIKLKVQKEVLNGAVLEQSFLVEYVVQDQMCESCSRVQANPDQWVAAVQLRQQVPHRRTFFYLEQLILKHDAAIRAIRIRQMDRGIDFFFSNRSHAVKFVEFVNKVAPIKSRHDKQLVSQDSKSNNYHYKYTFSVEI | ||||||
Domain | 251-296 | 60S ribosomal export protein NMD3 SH3 | ||||
Sequence: ICREDLVCLPPKVASALGNIGPIVICTKITNAIAFLDPLTLRTCFL | ||||||
Domain | 315-404 | 60S ribosomal export protein NMD3 OB-fold | ||||
Sequence: LVEYIVLDLEIISNVVDVSGSKYVMADVQVARVSDFGKNDTMFFVRTHLGHLLNPGDFALGYDLHAANCNDIEIGKYKGLVIPEVILVKK |
Sequence similarities
Belongs to the NMD3 family.
Family and domain databases
Sequence
- Sequence statusFragment
- Length476
- Mass (Da)54,812
- Last updated2015-01-07 v1
- Checksum1161BD89DAB9C829
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 476 | |||||
Sequence: E |