A0A076HRA6 · A0A076HRA6_9BACT
- ProteinACT domain-containing protein
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids814 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Bifunctional aspartate kinase and homoserine dehydrogenase that catalyzes the first and the third steps toward the synthesis of lysine, methionine and threonine from aspartate.
Catalytic activity
- ATP + L-aspartate = 4-phospho-L-aspartate + ADPThis reaction proceeds in the forward direction.
Pathway
Amino-acid biosynthesis; L-lysine biosynthesis via DAP pathway; (S)-tetrahydrodipicolinate from L-aspartate: step 1/4.
Amino-acid biosynthesis; L-methionine biosynthesis via de novo pathway; L-homoserine from L-aspartate: step 1/3.
Amino-acid biosynthesis; L-methionine biosynthesis via de novo pathway; L-homoserine from L-aspartate: step 3/3.
Amino-acid biosynthesis; L-threonine biosynthesis; L-threonine from L-aspartate: step 1/5.
Amino-acid biosynthesis; L-threonine biosynthesis; L-threonine from L-aspartate: step 3/5.
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | aspartate kinase activity | |
Molecular Function | ATP binding | |
Molecular Function | homoserine dehydrogenase activity | |
Molecular Function | NADP binding | |
Biological Process | lysine biosynthetic process via diaminopimelate | |
Biological Process | threonine biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameACT domain-containing protein
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Bacteroidota > Cytophagia > Cytophagales > Hymenobacteraceae > Hymenobacter
Accessions
- Primary accessionA0A076HRA6
Proteomes
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 400-478 | ACT | ||||
Sequence: LVGEQMRNHSGISGRMFGALGNNGVNIRAIAQGSSERNISVVIRAHDVRKAINVLHEDFFEESVKQVNVFVAGVGNVGG |
Sequence similarities
Belongs to the aspartokinase family.
In the C-terminal section; belongs to the homoserine dehydrogenase family.
In the N-terminal section; belongs to the aspartokinase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length814
- Mass (Da)87,817
- Last updated2014-10-29 v1
- Checksum86E3B6043825E823
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP006587 EMBL· GenBank· DDBJ | AII52066.1 EMBL· GenBank· DDBJ | Genomic DNA |