UniParc · UPI0000165554

Sequence

  • Length
    244
  • Mass (Da)
    27,123
  • Checksum
    AC1D7A73244D7AC0
MAEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR

Cross references

For performance reasons, this entry is not populated with all of its cross-references because it has too many of them. If you do need to retrieve all of them, feel free to Contact us.
DatabaseIdentifierVersionOrganismFirst seenLast seenActive
UniProtKB reviewedP0AC472Escherichia coli (strain K12)Yes
UniProtKB reviewedP0AC482Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)Yes
UniProtKB reviewedP0AC492Escherichia coli O157:H7Yes
UniProtKB reviewedP0AC502Shigella flexneriYes
UniProtKB unreviewedQ31T881Shigella boydii serotype 4 (strain Sb227)Yes
UniProtKB unreviewedQ0SXC31Shigella flexneri serotype 5b (strain 8401)Yes
UniProtKB unreviewedA7ZV261Escherichia coli O139:H28 (strain E24377A / ETEC)Yes
UniProtKB unreviewedB1LQH61Escherichia coli (strain SMS-3-5 / SECEC)Yes
UniProtKB unreviewedB2TY311Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)Yes
UniProtKB unreviewedB7LC111Escherichia coli (strain 55989 / EAEC)Yes
UniProtKB unreviewedB7LLT71Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)Yes
UniProtKB unreviewedB7UPX51Escherichia coli O127:H6 (strain E2348/69 / EPEC)Yes
UniProtKB unreviewedB7NG921Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)Yes
UniProtKB unreviewedB7MSX01Escherichia coli O81 (strain ED1a)Yes
UniProtKB unreviewedC3SGB21Escherichia coliYes
UniProtKB unreviewedD2AF361Shigella flexneri serotype X (strain 2002017)Yes
UniProtKB unreviewedD3GV551Escherichia coli O44:H18 (strain 042 / EAEC)Yes
UniProtKB unreviewedD8AFK81Escherichia coli (strain MS 21-1)Yes
UniProtKB unreviewedE0J0441Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)Yes
UniProtKB unreviewedE1J2P71Escherichia coli MS 124-1Yes
UniProtKB unreviewedI6C8L41Shigella flexneri K-315Yes
UniProtKB unreviewedI6DCC91Shigella boydii 4444-74Yes
UniProtKB unreviewedW1W1021Escherichia coli DORA_A_5_14_21Yes
UniProtKB unreviewedA0A0E0Y6L51Escherichia coli O104:H4 (strain 2011C-3493)Yes
UniProtKB unreviewedA0A0H3MN561Escherichia coli O7:K1 (strain IAI39 / ExPEC)Yes
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp