UniParc · UPI000011044B

Sequence

  • Length
    396
  • Mass (Da)
    43,573
  • Checksum
    9F0437E76DD4FC0F
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL

Cross references

For performance reasons, this entry is not populated with all of its cross-references because it has too many of them. If you do need to retrieve all of them, feel free to Contact us.
DatabaseIdentifierVersionOrganismFirst seenLast seenActive
UniProtKB unreviewedA0A1S9JFZ11Shigella boydiiYes
UniProtKB unreviewedA0A1Q8M8R01Shigella boydiiNo
EMBLWGSOOO818521Shigella boydiiYes
EMBLWGSOWR201781Shigella boydiiYes
EMBLWGSOYG858091Shigella boydiiYes
EMBLWGSOYJ002371Shigella boydiiYes
EMBLWGSOYJ495011Shigella boydiiYes
EMBLWGSOYK699451Shigella boydiiYes
EMBLWGSOYL459491Shigella boydiiYes
EMBLWGSPAY865161Shigella boydiiYes
EMBLWGSPAY988381Shigella boydiiYes
EMBLWGSPBO973361Shigella boydiiYes
EMBLWGSPHU722521Shigella boydiiYes
EMBLWGSPHU852961Shigella boydiiYes
EMBLWGSPHU942481Shigella boydiiYes
EMBLWGSPQN341691Shigella boydiiYes
EMBLWGSPQN579211Shigella boydiiYes
EMBLWGSSPZ868091Shigella boydiiYes
EMBLWGSRCW056821Shigella boydiiYes
EMBLWGSRIE988351Shigella boydiiYes
EMBLWGSRIF495391Shigella boydiiYes
EMBLWGSRIF670331Shigella boydiiYes
EMBLWGSRIF709631Shigella boydiiYes
EMBLWGSRIF795431Shigella boydiiYes
EMBLWGSRIG793221Shigella boydiiYes
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp