UniParc · UPI000011044B

Sequence

  • Length
    396
  • Mass (Da)
    43,573
  • Checksum
    9F0437E76DD4FC0F
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL

Cross references

For performance reasons, this entry is not populated with all of its cross-references because it has too many of them. If you do need to retrieve all of them, feel free to Contact us.
DatabaseIdentifierVersionOrganismFirst seenLast seenActive
EMBLBAA356741Escherichia coli (strain K12 / W3110 / ATCC 27325 / DSM 5911)Yes
EMBLAAZ876701Shigella sonnei (strain Ss046)Yes
EMBLABB624061Shigella dysenteriae serotype 1 (strain Sd197)Yes
EMBLACB021281Escherichia coli (strain K12 / DH10B)Yes
EMBLBAG765111Escherichia coli (strain SE11)Yes
EMBLCAQ978331Escherichia coli O8 (strain IAI1)Yes
EMBLCAR123311Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)Yes
EMBLCAU968391Escherichia coli (strain 55989 / EAEC)Yes
EMBLACR620201Escherichia coli (strain K12 / MC4100 / BW2952)Yes
EMBLCAQ314561Escherichia coli (strain B / BL21-DE3)Yes
EMBLBAI298221Escherichia coli O103:H2 (strain 12009 / EHEC)Yes
EMBLBAI349511Escherichia coli O111:H- (strain 11128 / EHEC)Yes
EMBLCBG338421Escherichia coli O44:H18 (strain 042 / EAEC)Yes
EMBLCBJ005041Escherichia coli O78:H11 (strain H10407 / ETEC)Yes
EMBLBAJ427351Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIMB 12045 / K12 / DH1)Yes
EMBLADT745401Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)Yes
EMBLAEE557041Escherichia coli UMNK88Yes
EMBLBAL380661Escherichia coli str. K-12 substr. MDS42Yes
EMBLABV053851Escherichia coli O9:H4 (strain HS)Yes
EMBLABV183891Escherichia coli O139:H28 (strain E24377A / ETEC)Yes
EMBLACA782971Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)Yes
EMBLACB180411Escherichia coli (strain SMS-3-5 / SECEC)Yes
EMBLACD097451Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)Yes
EMBLACT296891Escherichia coli 'BL21-Gold(DE3)pLysS AG'Yes
EMBLACT386141Escherichia coli (strain B / REL606)Yes
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp