Essential maintenance is planned to begin on Fri Jan 24 2025. The website may be temporarily unavailable. Please use our fallback: https://wwwdev.ebi.ac.uk/uniprot/front-end/fallback/ in case of any outage.

UniRef · UniRef100_B3TN77 (100%)

  • Cluster name
    Protein PsbN
  • Composition
    3,787 members
  • Last updated
  • Seed
    Built on sequence A0A6M8TZP9
  • Common taxon
    Top level (root)

Representative

  • Length
    43
  • Mass (Da)
    4,662
  • MD5 Checksum
    0DE6F8E384D50F890DD16BC55949FC8E
METATLVAISISGLLVSFTGYALYTAFGQPSQQLRDPFEEHGD

3,787 members

Expand cluster to 50% or 90% identity
Cluster MembersEntry namesProtein namesOrganismsOrganism IDsRelated clustersLengthsRoles
PSBN_BRADIProtein PsbNBrachypodium distachyon (Purple false brome) (Trachynia distachya)15368UniRef50_A8W3L1 UniRef90_A8W3E9 43representative
PSBN_ANACOProtein PsbNAnanas comosus (Pineapple) (Ananas ananas)4615UniRef90_A8W3E9 43
PSBN_AGRSTProtein PsbNAgrostis stolonifera (Creeping bentgrass)63632UniRef90_A8W3E9 43
PSBN_BUTUMProtein PsbNButomus umbellatus (Flowering rush)50236UniRef90_A8W3E9 43
PSBN_CABCAProtein PsbNCabomba caroliniana (Carolina fanwort)4426UniRef90_A8W3E9 43
PSBN_CARPAProtein PsbNCarica papaya (Papaya)3649UniRef90_A8W3E9 43
PSBN_CERDEProtein PsbNCeratophyllum demersum (Rigid hornwort) (Coontail)4428UniRef90_A8W3E9 43
PSBN_CERJAProtein PsbNCercidiphyllum japonicum (Katsura tree)13413UniRef90_A8W3E9 43
PSBN_CITSIProtein PsbNCitrus sinensis (Sweet orange) (Citrus aurantium var. sinensis)2711UniRef90_A8W3E9 43
PSBN_CUCSAProtein PsbNCucumis sativus (Cucumber)3659UniRef90_A8W3E9 43
PSBN_EUCGGProtein PsbNEucalyptus globulus subsp. globulus (Tasmanian blue gum)71271UniRef90_A8W3E9 43
PSBN_GOSBAProtein PsbNGossypium barbadense (Sea Island cotton) (Hibiscus barbadensis)3634UniRef90_A8W3E9 43
PSBN_GOSHIProtein PsbNGossypium hirsutum (Upland cotton) (Gossypium mexicanum)3635UniRef90_A8W3E9 43
PSBN_GUNCHProtein PsbNGunnera chilensis (Chilean rhubarb)130722UniRef90_A8W3E9 43
PSBN_HORVUProtein PsbNHordeum vulgare (Barley)4513UniRef90_A8W3E9 43
PSBN_LEMMIProtein PsbNLemna minor (Common duckweed)4472UniRef90_A8W3E9 43
PSBN_LOLPRProtein PsbNLolium perenne (Perennial ryegrass)4522UniRef90_A8W3E9 43
PSBN_LOTJAProtein PsbNLotus japonicus (Lotus corniculatus var. japonicus)34305UniRef90_A8W3E9 43
PSBN_MAIZEProtein PsbNZea mays (Maize)4577UniRef90_A8W3E9 43
PSBN_MANESProtein PsbNManihot esculenta (Cassava) (Jatropha manihot)3983UniRef90_A8W3E9 43
PSBN_OENARProtein PsbNOenothera argillicola (Appalachian evening primrose)3940UniRef90_A8W3E9 43
PSBN_OENBIProtein PsbNOenothera biennis (German evening primrose) (Onagra biennis)3942UniRef90_A8W3E9 43
PSBN_OENEHProtein PsbNOenothera elata subsp. hookeri (Hooker's evening primrose) (Oenotherahookeri)85636UniRef90_A8W3E9 43
PSBN_OENGLProtein PsbNOenothera glazioviana (Large-flowered evening primrose) (Oenotheraerythrosepala)482428UniRef90_A8W3E9 43
PSBN_OENPAProtein PsbNOenothera parviflora (Small-flowered evening primrose) (Oenotheracruciata)482429UniRef90_A8W3E9 43
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help