Essential maintenance is planned to begin on Fri Jan 24 2025. The website may be temporarily unavailable. Please use our fallback: https://wwwdev.ebi.ac.uk/uniprot/front-end/fallback/ in case of any outage.

W5LMX2 · W5LMX2_ASTMX

Function

function

Fatty acyl-coenzyme A (CoA) diphosphatase that hydrolyzes fatty acyl-CoA to yield acyl-4'-phosphopantetheine and adenosine 3',5'-bisphosphate. Mediates the hydrolysis of a wide range of CoA esters, including choloyl-CoA and branched-chain fatty-acyl-CoA esters and at low substrate concentrations medium and long-chain fatty-acyl-CoA esters are the primary substrates. Highest activity seen with medium-chain acyl-CoA esters and higher rates of activity seen with the unsaturated acyl-CoA esters compared with the saturated esters. Exhibits decapping activity towards dpCoA-capped RNAs in vitro.

Catalytic activity

  • (6Z)-octenoyl-CoA + H2O = S-(6Z-octenoyl)-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • (9Z)-hexadecenoyl-CoA + H2O = S-(9Z-hexadecenoyl)-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • (9Z)-tetradecenoyl-CoA + H2O = S-(9Z-tetradecenoyl)-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • (9Z,12Z)-octadecadienoyl-CoA + H2O = S-(9Z,12Z-octadecadienoyl)-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • (9Z,12Z,15Z)-octadecatrienoyl-CoA + H2O = S-(9Z,12Z,15Z-octadecatrienoyl)-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • 4,8-dimethylnonanoyl-CoA + H2O = S-(4,8-dimethylnonanoyl)-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • CoA + H2O = (R)-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
    EC:3.6.1.77 (UniProtKB | ENZYME | Rhea)
  • hexadecanoyl-CoA + H2O = S-hexadecanoyl-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • hexanoyl-CoA + H2O = hexanoyl-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • malonyl-CoA + H2O = malonyl-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • octanoyl-CoA + H2O = S-octanoyl-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • propanoyl-CoA + H2O = propanoyl-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • succinyl-CoA + H2O = succinyl-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • tetradecanoyl-CoA + H2O = tetradecanoyl-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • a 5'-end CoA-ribonucleoside in mRNA + H2O = a 5'-end phospho-adenosine-phospho-ribonucleoside in mRNA + (R)-4'-phosphopantetheine + 2 H+
    This reaction proceeds in the forward direction.
  • an acyl-CoA + H2O = an acyl-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • butanoyl-CoA + H2O = S-butanoyl-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • choloyl-CoA + H2O = S-choloyl-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.
  • dodecanoyl-CoA + H2O = S-dodecanoyl-4'-phosphopantetheine + adenosine 3',5'-bisphosphate + 2 H+
    This reaction proceeds in the forward direction.

Cofactor

Protein has several cofactor binding sites:
Mg2+ (UniProtKB | Rhea| CHEBI:18420 )

Mn2+ (UniProtKB | Rhea| CHEBI:29035 )

GO annotations

AspectTerm
Cellular Componentmitochondrion
Molecular Functionhydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
Molecular Functionmetal ion binding

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    Acyl-coenzyme A diphosphatase NUDT19
  • EC number
  • Alternative names
    • Nucleoside diphosphate-linked moiety X motif 19

Organism names

Accessions

  • Primary accession
    W5LMX2

Proteomes

Subcellular Location

Expression

Gene expression databases

Interaction

Protein-protein interaction databases

Family & Domains

Features

Showing features for domain, region.

Type
IDPosition(s)Description
Domain20-259Nudix hydrolase
Region309-332Disordered

Sequence similarities

Belongs to the Nudix hydrolase family.

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    381
  • Mass (Da)
    43,102
  • Last updated
    2018-12-05 v2
  • MD5 Checksum
    DB87144038697C3759D6D64AF10F9DB4
MNTALKHWKEAATVILVAGMKRSPAASVPHKSAFNYKVLLLKRSGKSGFMPNAHVFPGGLAEASDFSPEWLDLFEPFRTLPNFGVGLVKQPPETRPPMFATDRLKLGSPVPGDVAFRICAVRETFEEAGVLLVVPRKDAAEHRSRSVPAALSELCDRSEMARWRSLVIQNSSNFIHMCRELQCLPNIWAMHEWGNWLTPIGLHGKQRRYDTAFYLCCLKDIPDTVQDEKEIVHFEWSTPSEVLRSFRDREVWIAPPQFYDLGRMSNFHLLSDLHDFAKSRSVEGCEQWLPVHLAATDCHVSLLPGDSMYPETPDYTGKTKSSLPSEKSLEELQKESPNLHRIVIHDLYTTSAYVNITPKYRHLPPLTSAALNSQSNHDSKL

Keywords

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help