S4Z2X7 · S4Z2X7_TRIMO
- ProteinATP synthase subunit c, chloroplastic
- GeneatpH
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
F1F0 ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F1 containing the extramembraneous catalytic core and F0 containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
Key component of the F0 channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F1 delta and epsilon subunits.
Miscellaneous
In plastids the F-type ATPase is also known as CF1CF0.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 61 | Reversibly protonated during proton transport | ||||
Sequence: E |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | proton-transporting ATP synthase complex, coupling factor F(o) | |
Molecular Function | lipid binding | |
Molecular Function | proton-transporting ATP synthase activity, rotational mechanism |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameATP synthase subunit c, chloroplastic
- Alternative names
Gene names
Encoded on
- Chloroplast
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Pooideae > Triticodae > Triticeae > Triticinae > Triticum
Accessions
- Primary accessionS4Z2X7
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Plastid, chloroplast thylakoid membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 57-77 | Helical | ||||
Sequence: LAFMEALTIYGLVVALALLFA |
Keywords
- Cellular component
Interaction
Subunit
F-type ATPases have 2 components, F1 - the catalytic core - and F0 - the membrane proton channel. F1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. F0 has four main subunits: a1, b1, b'1 and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F1 is attached to F0 by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta, b and b' chains.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 11-73 | V-ATPase proteolipid subunit C-like | ||||
Sequence: IAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALA |
Sequence similarities
Belongs to the ATPase C chain family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length81
- Mass (Da)7,974
- Last updated2013-10-16 v1
- Checksum75F8DBD4F23A896D
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KC912690 EMBL· GenBank· DDBJ | AGP50985.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KY636155 EMBL· GenBank· DDBJ | ASD46261.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KY636156 EMBL· GenBank· DDBJ | ASD46339.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KY636157 EMBL· GenBank· DDBJ | ASD46415.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KY636158 EMBL· GenBank· DDBJ | ASD46492.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KY636160 EMBL· GenBank· DDBJ | ASD46632.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KY636161 EMBL· GenBank· DDBJ | ASD46710.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KY636162 EMBL· GenBank· DDBJ | ASD46789.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG958551 EMBL· GenBank· DDBJ | QBK82950.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG958558 EMBL· GenBank· DDBJ | QBK83524.1 EMBL· GenBank· DDBJ | Genomic DNA |