Q8M9X4 · YCF4_CHAGL
- ProteinPhotosystem I assembly protein Ycf4
- Geneycf4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids184 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Seems to be required for the assembly of the photosystem I complex.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | photosystem I | |
Biological Process | photosynthesis |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended namePhotosystem I assembly protein Ycf4
Gene names
Encoded on
- Chloroplast
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Coleochaetophyceae > Coleochaetales > Chaetosphaeridiaceae > Chaetosphaeridium
Accessions
- Primary accessionQ8M9X4
Subcellular Location
UniProt Annotation
GO Annotation
Plastid, chloroplast thylakoid membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 21-43 | Helical | ||||
Sequence: NYFWATVVFLGSLGFFIVGVSSY | ||||||
Transmembrane | 63-85 | Helical | ||||
Sequence: GIVMCFYGIAGLFLSFYLWFTIF |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000217600 | 1-184 | Photosystem I assembly protein Ycf4 | |||
Sequence: MNIKSEFFRVDFIIGARRLSNYFWATVVFLGSLGFFIVGVSSYLQKNIVFFLSASDILFTPQGIVMCFYGIAGLFLSFYLWFTIFLDIGSGYNEFDKKKGIISIFRWGYPGQNRRIKLSFPIKDVQAIKLEVKEVLPARRMIYIKIKGQQDIPLNRIAENITLREMEDKAADLARFLKVSIEGL |
Structure
Sequence
- Sequence statusComplete
- Length184
- Mass (Da)21,223
- Last updated2002-10-01 v1
- Checksum0EC0BE49AC88FA2F
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF494278 EMBL· GenBank· DDBJ | AAM96584.1 EMBL· GenBank· DDBJ | Genomic DNA |