Q7Y0F6 · SPX5_ORYSJ
- ProteinSPX domain-containing protein 5
- GeneSPX5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids247 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Functional repressor of PHR2 (PubMed:24368504).
Involved in maintaining cellular Pi homeostasis when plants are exposed to an external change in Pi (PubMed:24368504).
Negatively regulates root-to-shoot Pi translocation redundantly with SPX3 (PubMed:24368504).
Involved in maintaining cellular Pi homeostasis when plants are exposed to an external change in Pi (PubMed:24368504).
Negatively regulates root-to-shoot Pi translocation redundantly with SPX3 (PubMed:24368504).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Biological Process | cellular response to cold | |
Biological Process | cellular response to phosphate starvation |
Names & Taxonomy
Protein names
- Recommended nameSPX domain-containing protein 5
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ7Y0F6
- Secondary accessions
Proteomes
Genome annotation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000398355 | 1-247 | SPX domain-containing protein 5 | |||
Sequence: MKFGKRLKRQIEESLPEWRDHFLNYKELKRRLNAVSSPDPAAEARFLALLHAEVDKFNAFFLEQEEDFVIRQRELQERIQSSSSAAAEMEGRVRREVVDLHGEMVLLLNYSSINYTGLAKILKKYDKRTGGVLRLPVIAGVLRQPFYATDLLSSLVRDCEAIMDAVFPSLPSPSAAAAAAARAAAEQAIFRNTVAALLTMQEVRSGSSTYGHFSLPPMTPLPDSDWLIQSVQPPPPPPPSSPLIIPT |
Proteomic databases
Interaction
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-139 | SPX | ||||
Sequence: MKFGKRLKRQIEESLPEWRDHFLNYKELKRRLNAVSSPDPAAEARFLALLHAEVDKFNAFFLEQEEDFVIRQRELQERIQSSSSAAAEMEGRVRREVVDLHGEMVLLLNYSSINYTGLAKILKKYDKRTGGVLRLPVIA | ||||||
Region | 224-247 | Disordered | ||||
Sequence: SDWLIQSVQPPPPPPPSSPLIIPT | ||||||
Compositional bias | 229-247 | Pro residues | ||||
Sequence: QSVQPPPPPPPSSPLIIPT |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length247
- Mass (Da)27,514
- Last updated2003-10-01 v1
- ChecksumAEB862975B2255CC
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0N7KHF0 | A0A0N7KHF0_ORYSJ | Os03g0406100 | 64 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 229-247 | Pro residues | ||||
Sequence: QSVQPPPPPPPSSPLIIPT |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KF267997 EMBL· GenBank· DDBJ | AHL42466.1 EMBL· GenBank· DDBJ | mRNA | ||
AC133932 EMBL· GenBank· DDBJ | AAP50928.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC134886 EMBL· GenBank· DDBJ | AAU89246.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DP000009 EMBL· GenBank· DDBJ | ABF96518.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008209 EMBL· GenBank· DDBJ | BAF12246.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014959 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CM000140 EMBL· GenBank· DDBJ | EAZ27274.1 EMBL· GenBank· DDBJ | Genomic DNA |