Q73FR5 · MNMA_WOLPM
- ProteintRNA-specific 2-thiouridylase MnmA
- GenemnmA
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids370 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s2U34.
Catalytic activity
- uridine34 in tRNA + S-sulfanyl-L-cysteinyl-[protein] + AH2 + ATP = 2-thiouridine34 in tRNA + L-cysteinyl-[protein] + A + AMP + diphosphate + H+
RHEA-COMP:11727 CHEBI:65315 Position: 34+ RHEA-COMP:11726 + CHEBI:17499 + CHEBI:30616 = RHEA-COMP:11728 CHEBI:87170 Position: 34+ RHEA-COMP:10131 + CHEBI:13193 + CHEBI:456215 + CHEBI:33019 + CHEBI:15378
Features
Showing features for binding site, active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 24-31 | ATP (UniProtKB | ChEBI) | ||||
Sequence: AMSGGVDS | ||||||
Binding site | 50 | ATP (UniProtKB | ChEBI) | ||||
Sequence: L | ||||||
Active site | 119 | Nucleophile | ||||
Sequence: C | ||||||
Binding site | 143 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Site | 144 | Interaction with tRNA | ||||
Sequence: H | ||||||
Active site | 215 | Cysteine persulfide intermediate | ||||
Sequence: C | ||||||
Site | 352 | Interaction with tRNA | ||||
Sequence: Q |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | ATP binding | |
Molecular Function | tRNA binding | |
Molecular Function | tRNA-uridine 2-sulfurtransferase activity | |
Biological Process | tRNA wobble position uridine thiolation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nametRNA-specific 2-thiouridylase MnmA
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageBacteria > Pseudomonadota > Alphaproteobacteria > Rickettsiales > Anaplasmataceae > Wolbachieae > Wolbachia
Accessions
- Primary accessionQ73FR5
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000349854 | 1-370 | tRNA-specific 2-thiouridylase MnmA | |||
Sequence: MLKEFEIEPLLKDKAPHQTKAVVAMSGGVDSSVAAALLHNLGYKVVGVTLQLYGTDGNANARKGACCAGQDIYDAKRVAESVGFPHYLLNYEEIFKKEVIEDFASTYMRGETPIPCVRCNQTVKFRDLLQVTKNLGADVLVTGHYVRRLEKNGEVKLCRSIDKSKDQSYFLFATTQEQLKLLRFPLGGFYKSDIRKLAKYFSLQISEKQDSQDICFVSESYSKTIAKLAPQSVQKGKIVDVNGKVLGEHSGIVNFTVGQRKGLGIAHNEPLYVIKINTENNEVIVGPINVLMQKKILIKELNWLEQPKEGMEVTVKLRSSHVGSLATIHSTDEKNKACVILNDDYFGISPGQACVAYKDEQVIGGGWICS | ||||||
Disulfide bond | 119↔215 | Alternate | ||||
Sequence: CNQTVKFRDLLQVTKNLGADVLVTGHYVRRLEKNGEVKLCRSIDKSKDQSYFLFATTQEQLKLLRFPLGGFYKSDIRKLAKYFSLQISEKQDSQDIC |
Keywords
- PTM
Structure
Sequence
- Sequence statusComplete
- Length370
- Mass (Da)41,015
- Last updated2004-07-05 v1
- ChecksumFE1FD6CF7DBE630C
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE017196 EMBL· GenBank· DDBJ | AAS14904.1 EMBL· GenBank· DDBJ | Genomic DNA |