Q6P767 · PTTG_RAT
- ProteinPituitary tumor-transforming gene 1 protein-interacting protein
- GenePttg1ip
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids174 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
May facilitate PTTG1 nuclear translocation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | plasma membrane | |
Molecular Function | p53 binding | |
Biological Process | negative regulation of DNA damage response, signal transduction by p53 class mediator | |
Biological Process | negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator | |
Biological Process | positive regulation of protein ubiquitination | |
Biological Process | protein import into nucleus |
Names & Taxonomy
Protein names
- Recommended namePituitary tumor-transforming gene 1 protein-interacting protein
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ6P767
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Note: May be cytoplasmic and nuclear.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 30-93 | Extracellular | ||||
Sequence: QEPPGVGCSEYTNRSCEECLRNVSCLWCNENKACLDYPVRKILPPASLCKLSSARWGVCWVNFE | ||||||
Transmembrane | 94-114 | Helical | ||||
Sequence: ALIITMSVLGGSVLLGITVCC | ||||||
Topological domain | 115-174 | Cytoplasmic | ||||
Sequence: CCCCRRKRSRKPDKSDERAMREQEERRVRQEERRAEMKSRHDEIRKKYGLFKEQNPYEKF |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-29 | |||||
Sequence: MASAVLGLTLRWVMFLSAVLLLLLPGASA | ||||||
Chain | PRO_0000022187 | 30-174 | Pituitary tumor-transforming gene 1 protein-interacting protein | |||
Sequence: QEPPGVGCSEYTNRSCEECLRNVSCLWCNENKACLDYPVRKILPPASLCKLSSARWGVCWVNFEALIITMSVLGGSVLLGITVCCCCCCRRKRSRKPDKSDERAMREQEERRVRQEERRAEMKSRHDEIRKKYGLFKEQNPYEKF | ||||||
Glycosylation | 42 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 51 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 171 | Phosphotyrosine | ||||
Sequence: Y |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for domain, region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 36-89 | PSI | ||||
Sequence: GCSEYTNRSCEECLRNVSCLWCNENKACLDYPVRKILPPASLCKLSSARWGVCW | ||||||
Region | 126-155 | Disordered | ||||
Sequence: PDKSDERAMREQEERRVRQEERRAEMKSRH | ||||||
Coiled coil | 127-163 | |||||
Sequence: DKSDERAMREQEERRVRQEERRAEMKSRHDEIRKKYG |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length174
- Mass (Da)19,900
- Last updated2004-07-05 v1
- Checksum61B77EF9FF4CF85E
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I5Y9S5 | A0A8I5Y9S5_RAT | Pttg1ip | 120 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC061813 EMBL· GenBank· DDBJ | AAH61813.1 EMBL· GenBank· DDBJ | mRNA |