Q6CPQ8 · MUS81_KLULA
- ProteinCrossover junction endonuclease MUS81
- GeneMUS81
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids614 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Interacts with EME1 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, D-loops, replication forks and nicked Holliday junctions. May be required in mitosis for the processing of stalled or collapsed replication fork intermediates. May be required in meiosis for the repair of meiosis-specific double strand breaks subsequent to single-end invasion (SEI) (By similarity).
Cofactor
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Holliday junction resolvase complex | |
Cellular Component | nucleus | |
Molecular Function | 3'-flap endonuclease activity | |
Molecular Function | crossover junction DNA endonuclease activity | |
Molecular Function | DNA binding | |
Molecular Function | metal ion binding | |
Biological Process | DNA catabolic process | |
Biological Process | double-strand break repair via break-induced replication | |
Biological Process | mitotic intra-S DNA damage checkpoint signaling | |
Biological Process | resolution of meiotic recombination intermediates |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCrossover junction endonuclease MUS81
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Kluyveromyces
Accessions
- Primary accessionQ6CPQ8
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000223645 | 1-614 | Crossover junction endonuclease MUS81 | |||
Sequence: MSIPSDAKQLYAEFLQQEVNQSTSAHQEKLVMVLNRALFALKNYPDPIYHPKDLLKVKGIGQTTMNKLSKRLKTYCEENGYSFPEESSSTDNTQSTQNDSNPSNTQKTRVRTLEPEENESQGTRKRRKKKYIPRNRSGGYGILLGLLELGCDKDGTACTRRQLIAVASKYCDQSYEKNPSTKEFYSAWSAIKSLKTNDLVIEQGRPSQFSLTEAGTILADSLKTANNIEFDVSSVYERRLNRGNTQNSFTNDEHDHTVNFSGLMNHANMSINESANSSRLFLDATANSSRIEQNEEPEVSAEISTPIPKQKVSKGRWKGVKYELWKPDSYDIILHIDHREVRSKEDRGFFARKLLQRGIETESSSLTVGDMIWLAKHKQSGQQCALDFIVERKRLDDLVISIRDNRFSEQKNRLQKTGCKHIFYLVEETTGYNVSDSADMMKTSIWTTVIYNDFHIKRTRNADTTVQWLTDMSLIIKELYSRKSLVVINHDHITNQSIYLTSLKMFRTEFERNKEIECCHNYESMQSAMVKTNLMTVKELYLRALMSVKGISLEKALMIQSRYPTFKTLLKAYRRCAAEADAKTLIQNELKDAPGNRKIGKSLSHTLWETFGKL |
Proteomic databases
Interaction
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 80-132 | Disordered | ||||
Sequence: GYSFPEESSSTDNTQSTQNDSNPSNTQKTRVRTLEPEENESQGTRKRRKKKYI | ||||||
Compositional bias | 81-109 | Polar residues | ||||
Sequence: YSFPEESSSTDNTQSTQNDSNPSNTQKTR | ||||||
Compositional bias | 110-124 | Basic and acidic residues | ||||
Sequence: VRTLEPEENESQGTR | ||||||
Domain | 333-430 | ERCC4 | ||||
Sequence: ILHIDHREVRSKEDRGFFARKLLQRGIETESSSLTVGDMIWLAKHKQSGQQCALDFIVERKRLDDLVISIRDNRFSEQKNRLQKTGCKHIFYLVEETT |
Sequence similarities
Belongs to the XPF family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length614
- Mass (Da)70,413
- Last updated2004-08-16 v1
- ChecksumA77B5B8FD8273F3C
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 81-109 | Polar residues | ||||
Sequence: YSFPEESSSTDNTQSTQNDSNPSNTQKTR | ||||||
Compositional bias | 110-124 | Basic and acidic residues | ||||
Sequence: VRTLEPEENESQGTR |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CR382125 EMBL· GenBank· DDBJ | CAG99168.1 EMBL· GenBank· DDBJ | Genomic DNA |