Q53B52 · 3SXZ_OPHHA
- ProteinShort neurotoxin OH-26
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
This three-finger toxin binds and inhibits the nicotinic acetylcholine receptor (nAChR).
Miscellaneous
Is classified as a P-type cytotoxin, since a proline residue stands at position 49 (Pro-31 in standard classification).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 28 | Important residue for inhibition of muscle alpha-1-beta-1-delta-epsilon and neuronal alpha-3-beta-2/CHRNA3-CHRNB2 nAChR | ||||
Sequence: H | ||||||
Site | 44 | Key residue for inhibition of muscle alpha-1-beta-1-delta-epsilon (CHRNA1-CHRNB1-CHRND-CHRNE) nAChR | ||||
Sequence: T | ||||||
Site | 46 | Key residue for inhibition of muscle alpha-1-beta-1-delta-epsilon (CHRNA1-CHRNB1-CHRND-CHRNE) and important for inhibition of neuronal alpha-3-beta-2/CHRNA3-CHRNB2 nAChR | ||||
Sequence: M | ||||||
Site | 48 | Key residue for inhibition of muscle alpha-1-beta-1-delta-epsilon (CHRNA1-CHRNB1-CHRND-CHRNE) and important residue for inhibition of neuronal alpha-3-beta-2/CHRNA3-CHRNB2 nAChR | ||||
Sequence: F | ||||||
Site | 51 | Important residue for inhibition of muscle alpha-1-beta-1-delta-epsilon (CHRNA1-CHRNB1-CHRND-CHRNE) and neuronal alpha-3-beta-2/CHRNA3-CHRNB2 nAChR | ||||
Sequence: H | ||||||
Site | 66 | Important residue for inhibition of muscle alpha-1-beta-1-delta-epsilon (CHRNA1-CHRNB1-CHRND-CHRNE) and neuronal alpha-3-beta-2/CHRNA3-CHRNB2 nAChR | ||||
Sequence: K |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | acetylcholine receptor inhibitor activity | |
Molecular Function | ion channel regulator activity | |
Molecular Function | toxin activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameShort neurotoxin OH-26
- Alternative names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Lepidosauria > Squamata > Bifurcata > Unidentata > Episquamata > Toxicofera > Serpentes > Colubroidea > Elapidae > Elapinae > Ophiophagus
Accessions
- Primary accessionQ53B52
Subcellular Location
Phenotypes & Variants
Toxic dose
LD50 is 160 ug/kg by intraperitoneal injection into mice.
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MKNLLLTFLVVTIVCLDLGYT | ||||||
Chain | PRO_5000093326 | 22-78 | Short neurotoxin OH-26 | |||
Sequence: LICHQRHGLQTCEPAQKFCFAQTVMPFPNHPLTLMGCTYSCPTEKNAVCCSTDKCNR | ||||||
Disulfide bond | 24↔40 | |||||
Sequence: CHQRHGLQTCEPAQKFC | ||||||
Disulfide bond | 33↔58 | |||||
Sequence: CEPAQKFCFAQTVMPFPNHPLTLMGC | ||||||
Disulfide bond | 62↔70 | |||||
Sequence: CPTEKNAVC | ||||||
Disulfide bond | 71↔76 | |||||
Sequence: CSTDKC |
Keywords
- PTM
Expression
Tissue specificity
Expressed by the venom gland.
Structure
Family & Domains
Sequence similarities
Belongs to the snake three-finger toxin family. Short-chain subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length78
- Mass (Da)8,756
- Last updated2005-05-24 v1
- Checksum1FDF616466E58123
Keywords
- Technical term