Q41228 · PSAEA_NICSY
- ProteinPhotosystem I reaction center subunit IV A, chloroplastic
- GenePSAEA
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids141 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
function
Stabilizes the interaction between PsaC and the PSI core, assists the docking of the ferredoxin to PSI and interacts with ferredoxin-NADP oxidoreductase.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | photosystem I reaction center | |
Biological Process | photosynthesis |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended namePhotosystem I reaction center subunit IV A, chloroplastic
- Short namesPSI-E A
- Cleaved into 1 chains
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Solanales > Solanaceae > Nicotianoideae > Nicotianeae > Nicotiana
Accessions
- Primary accessionQ41228
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-49 | Chloroplast | ||||
Sequence: MASCNMASAASNFLVATPNVASNTNTSRTTMLFFSSKNYGSTAPRLVVR | ||||||
Chain | PRO_0000029382 | 50-141 | Photosystem I reaction center subunit IV A, chloroplastic | |||
Sequence: AAEEAAPPAAAATAEPAEAPVKAAKPPPIGPKRGTKVRILRKESYWYKGTGSVVACDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEVK | ||||||
Chain | PRO_0000029383 | 51-141 | Photosystem I reaction center subunit IV A isoform 2 | |||
Sequence: AEEAAPPAAAATAEPAEAPVKAAKPPPIGPKRGTKVRILRKESYWYKGTGSVVACDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEVK |
Post-translational modification
2 isoforms exists (ratio 1:1). With or without the N-terminal alanine.
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length141
- Mass (Da)15,099
- Last updated1996-11-01 v1
- Checksum5F2F03F99DAA25F3
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
S72356 EMBL· GenBank· DDBJ | AAB31704.1 EMBL· GenBank· DDBJ | mRNA |