Q332U5 · RPOA_LACSA
- ProteinDNA-directed RNA polymerase subunit alpha
- GenerpoA
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids335 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
Catalytic activity
- RNA(n) + a ribonucleoside 5'-triphosphate = RNA(n+1) + diphosphate
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | DNA-directed RNA polymerase complex | |
Molecular Function | DNA binding | |
Molecular Function | DNA-directed 5'-3' RNA polymerase activity | |
Molecular Function | protein dimerization activity | |
Biological Process | DNA-templated transcription |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA-directed RNA polymerase subunit alpha
- EC number
- Short namesPEP
- Alternative names
Gene names
Encoded on
- Chloroplast
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > campanulids > Asterales > Asteraceae > Cichorioideae > Cichorieae > Lactucinae > Lactuca
Accessions
- Primary accessionQ332U5
- Secondary accessions
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000225922 | 1-335 | DNA-directed RNA polymerase subunit alpha | |||
Sequence: MVREKITVSTRTLQWKCVESAADSKRLLYGRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRAKSEKISHEYSTIMGIQESVHEILMNLKEIVLRSNLYGTCEASICVRGPGYVTAQDIILPPYVEILDNTQHIASLTEPIELVIGLQIEKNRGYLIKAPNTFQDGSYPIDPVFMPVRNANHSIHSYENGNKEILFLEIWTNGSLTPKEALYEASRNLIDLLIPFLHTKEENLNLEGNQHMVPLPPFTFYDKLAKLTKNKKKMALKSIFIDQSELPPRIYNCLKRSNIYTLLDLLNNSQEDLMKMEHFRIEDVKQILGILEKNFVIDLPKNKF |
Interaction
Subunit
In plastids the minimal PEP RNA polymerase catalytic core is composed of four subunits: alpha, beta, beta', and beta''. When a (nuclear-encoded) sigma factor is associated with the core the holoenzyme is formed, which can initiate transcription.
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-231 | Alpha N-terminal domain (alpha-NTD) | ||||
Sequence: MVREKITVSTRTLQWKCVESAADSKRLLYGRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRAKSEKISHEYSTIMGIQESVHEILMNLKEIVLRSNLYGTCEASICVRGPGYVTAQDIILPPYVEILDNTQHIASLTEPIELVIGLQIEKNRGYLIKAPNTFQDGSYPIDPVFMPVRNANHSIHSYENGNKEILFLEIWTNGSLTPKEALYEASRNLIDLLIPFLHTK | ||||||
Region | 263-335 | Alpha C-terminal domain (alpha-CTD) | ||||
Sequence: KKMALKSIFIDQSELPPRIYNCLKRSNIYTLLDLLNNSQEDLMKMEHFRIEDVKQILGILEKNFVIDLPKNKF |
Domain
The N-terminal domain is essential for RNAP assembly and basal transcription, whereas the C-terminal domain is involved in interaction with transcriptional regulators and with upstream promoter elements.
Sequence similarities
Belongs to the RNA polymerase alpha chain family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length335
- Mass (Da)38,294
- Last updated2005-12-06 v1
- ChecksumEEB3AD56F6CE1E28
Sequence caution
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP007232 EMBL· GenBank· DDBJ | BAE47627.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ383816 EMBL· GenBank· DDBJ | ABD47264.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation |