Q2HEW1 · CHEG_CHAGB
- ProteinCytochrome P450 monooxygenase cheG
- GenecheG
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids340 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of chaetoglobosin A which has a unique inhibitory activity against actin polymerization in mammalian cells (PubMed:23611317, PubMed:33622536).
Chaetoglobosin A and its intermediates are involved in the morphological differentiation of C.globosum (PubMed:33622536).
The first step of the pathway is the synthesis of prochaetoglobosin I via condensation of one acetyl-CoA, 8 malonyl-CoA, and a L-tryptophan molecule by the PKS-NRPS hybrid synthetase cheA, followed by reduction of backbone double bond to install desired geometry by the enoyl reductase cheB (PubMed:23611317).
Further multiple oxidation steps performed by the cytochrome P450 monooxygenases cheE and cheG, as well as by the FAD-linked oxidoreductase cheF, lead to the formation of chaetoglobosin A (PubMed:23611317).
Depending on the order of action of these reductases, distinct intermediates can be identified (PubMed:23611317).
Within the pathway, the cytochrome P450 monooxygenase cheE catalyzes a stereospecific epoxidation on prochaetoglobosin I, cytoglobosin D, and chaetoglobosin J intermediates (PubMed:23611317).
The FAD-linked oxidoreductase cheF performs dehydrogenation of the C-20 hydroxyl groups in the 20-dihyrochaetoglobosin A and cytoglobosin D intermediates (PubMed:23611317).
Finally, the cytochrome P450 monooxygenase cheG can catalyze the stereospecific dihydroxylation of prochaetoglobosin I and prochaetoglobosin IV at C-19 and C-20, respectively (PubMed:23611317).
The Diels-Alderase cheD may play a role in the post-PKS-NRPS biosynthetic steps catalyzing Diels-Alder cyclization (Probable)
Chaetoglobosin A and its intermediates are involved in the morphological differentiation of C.globosum (PubMed:33622536).
The first step of the pathway is the synthesis of prochaetoglobosin I via condensation of one acetyl-CoA, 8 malonyl-CoA, and a L-tryptophan molecule by the PKS-NRPS hybrid synthetase cheA, followed by reduction of backbone double bond to install desired geometry by the enoyl reductase cheB (PubMed:23611317).
Further multiple oxidation steps performed by the cytochrome P450 monooxygenases cheE and cheG, as well as by the FAD-linked oxidoreductase cheF, lead to the formation of chaetoglobosin A (PubMed:23611317).
Depending on the order of action of these reductases, distinct intermediates can be identified (PubMed:23611317).
Within the pathway, the cytochrome P450 monooxygenase cheE catalyzes a stereospecific epoxidation on prochaetoglobosin I, cytoglobosin D, and chaetoglobosin J intermediates (PubMed:23611317).
The FAD-linked oxidoreductase cheF performs dehydrogenation of the C-20 hydroxyl groups in the 20-dihyrochaetoglobosin A and cytoglobosin D intermediates (PubMed:23611317).
Finally, the cytochrome P450 monooxygenase cheG can catalyze the stereospecific dihydroxylation of prochaetoglobosin I and prochaetoglobosin IV at C-19 and C-20, respectively (PubMed:23611317).
The Diels-Alderase cheD may play a role in the post-PKS-NRPS biosynthetic steps catalyzing Diels-Alder cyclization (Probable)
Cofactor
Pathway
Secondary metabolite biosynthesis.
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Molecular Function | heme binding | |
Molecular Function | iron ion binding | |
Molecular Function | monooxygenase activity | |
Molecular Function | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCytochrome P450 monooxygenase cheG
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Sordariomycetes > Sordariomycetidae > Sordariales > Chaetomiaceae > Chaetomium
Accessions
- Primary accessionQ2HEW1
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 37-57 | Helical | ||||
Sequence: MLLGIPTVILSLTPAVLRLLI |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Impairs the production of chaetoglobosin A but leads to the accumulation of prochaetoglobosin IV (PubMed:23611317).
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000438245 | 1-340 | Cytochrome P450 monooxygenase cheG | |||
Sequence: MFPALQKIVVSTNASPLVGRELASNSTWIWHVERLPMLLGIPTVILSLTPAVLRLLIKPLLFVPIRYSSFVLTRLITPVLKEDMLEFESTADKKSPAGPKAKGKLALTSWLLSRYPASLKDRMSQLIRDYLAITFESTPSTSGVLFYILIELAAAPELAEAVRRELREVAPNGELPSTHLNELKVMDSVMRESARVNPFSHLVLYRKLLRPLKLEGCPELPAGCFICVDAHHIDFSPQLWENPERFDGLRHYRARQKPENGNRFKFANLGSDAPGWGDGPQACPGRMFADNTIKIILAHILTHYDLELPPGQGKPEKGSMPNGSMSPDTKAKVLFRSRKL | ||||||
Glycosylation | 25 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 322 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
PTM databases
Expression
Induction
Expression is positively regulated by the cluster-specific transcription factor cheR that binds directly to an asymmetric direct repeat present in the promoter.
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 308-340 | Disordered | ||||
Sequence: LPPGQGKPEKGSMPNGSMSPDTKAKVLFRSRKL |
Sequence similarities
Belongs to the cytochrome P450 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length340
- Mass (Da)37,995
- Last updated2006-03-21 v1
- Checksum782A629292BF0FEF
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CH408029 EMBL· GenBank· DDBJ | EAQ93008.1 EMBL· GenBank· DDBJ | Genomic DNA |