Q16BI0 · ACCA_ROSDO
- ProteinAcetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
- GeneaccA
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids320 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Component of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO2 group is transferred by the carboxyltransferase to acetyl-CoA to form malonyl-CoA.
Catalytic activity
- acetyl-CoA + N6-carboxybiotinyl-L-lysyl-[protein] = malonyl-CoA + N6-biotinyl-L-lysyl-[protein]
Pathway
Lipid metabolism; malonyl-CoA biosynthesis; malonyl-CoA from acetyl-CoA: step 1/1.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | acetyl-CoA carboxylase complex | |
Molecular Function | acetyl-CoA carboxylase activity | |
Molecular Function | ATP binding | |
Molecular Function | carboxyl- or carbamoyltransferase activity | |
Biological Process | fatty acid biosynthetic process | |
Biological Process | malonyl-CoA biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAcetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
- EC number
- Short namesACCase subunit alpha ; Acetyl-CoA carboxylase carboxyltransferase subunit alpha
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Alphaproteobacteria > Rhodobacterales > Roseobacteraceae > Roseobacter
Accessions
- Primary accessionQ16BI0
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_1000062668 | 1-320 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha | |||
Sequence: MTQYMDFEKPLAEIEGKAEELRALARANEEMDVTDEASALDAKARKMLEELYGALTPWRKCQVARHPERPHCQDYINALFTDYTPLAGDRNFADDHAILGGLARLQDRPVMVIGHEKGNDTKSRIERNFGMARPEGYRKAIRLMEMADRFNLPVVTLVDTPGAYPGKGAEERGQSEAIARSTEKCLQIGVPLVSVVIGEGGSGGAVAFATANRVAMLEHSVYSVISPEGCASILWKDAEKMREAAEALRLTAQDLKQLGVIDRIIPEPLGGAHRHKETTIASVGAALGEMIAELSAMDRAALITERRNKFLELGSKGLAA |
Interaction
Subunit
Acetyl-CoA carboxylase is a heterohexamer composed of biotin carboxyl carrier protein (AccB), biotin carboxylase (AccC) and two subunits each of ACCase subunit alpha (AccA) and ACCase subunit beta (AccD).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 39-293 | CoA carboxyltransferase C-terminal | ||||
Sequence: ALDAKARKMLEELYGALTPWRKCQVARHPERPHCQDYINALFTDYTPLAGDRNFADDHAILGGLARLQDRPVMVIGHEKGNDTKSRIERNFGMARPEGYRKAIRLMEMADRFNLPVVTLVDTPGAYPGKGAEERGQSEAIARSTEKCLQIGVPLVSVVIGEGGSGGAVAFATANRVAMLEHSVYSVISPEGCASILWKDAEKMREAAEALRLTAQDLKQLGVIDRIIPEPLGGAHRHKETTIASVGAALGEMIAE |
Sequence similarities
Belongs to the AccA family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length320
- Mass (Da)34,941
- Last updated2006-07-25 v1
- ChecksumEB28AC10B5C1710D
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP000362 EMBL· GenBank· DDBJ | ABG30663.1 EMBL· GenBank· DDBJ | Genomic DNA |