Q0P3P3 · ATPE_OSTTA
- ProteinATP synthase epsilon chain, chloroplastic
- GeneatpE
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids142 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Produces ATP from ADP in the presence of a proton gradient across the membrane.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | proton-transporting ATP synthase complex, catalytic core F(1) | |
Molecular Function | ATP binding | |
Molecular Function | proton-transporting ATP synthase activity, rotational mechanism |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameATP synthase epsilon chain, chloroplastic
- Alternative names
Gene names
Encoded on
- Chloroplast
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Chlorophyta > Mamiellophyceae > Mamiellales > Bathycoccaceae > Ostreococcus
Accessions
- Primary accessionQ0P3P3
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000275210 | 1-142 | ATP synthase epsilon chain, chloroplastic | |||
Sequence: MEVCIVKPDRIFFKEEADELLLPTNTGYIGILKDHAPLVTGLDNGVLGVRQGTTWRFLALLGGFGVIKEGRVNILCRDIQDASEINLEEAEQLAATAKESMTKSDSKKGYIENQLKFDRETARVAAAKMYKESAGGSPVFGN |
Interaction
Subunit
F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. CF0 has three main subunits: a, b and c.
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length142
- Mass (Da)15,551
- Last updated2006-09-19 v1
- Checksum246DE987C0805C0B
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CR954199 EMBL· GenBank· DDBJ | CAL36334.1 EMBL· GenBank· DDBJ | Genomic DNA |