Q07957 · USF1_XENBO
- ProteinUpstream stimulatory factor 1
- Geneusf1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids307 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
May act as a regulator of transcription factor IIIA (TFIIIA) gene expression.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | protein dimerization activity | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameUpstream stimulatory factor 1
- Short namesUSF
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionQ07957
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000127499 | 1-307 | Upstream stimulatory factor 1 | |||
Sequence: MKGQQKVADIEEGTVRVQEEGAVATGEDPTSVAIASIQSAATFSDPNVKYVFRTENGGAQVMYRVIQVAEGQLDGQTEGTGAISGFPATQSMTQAVIQGAFTSDDNGETDASGPETHYTYFPTDSSTSVGGTPTTVVTTHNSDTLLGQAASTGTGQFYVMMSSQDVLQGGSQRSIAPRTHPYSPKSDGPRTTRDDKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKTGQSKGGILSKACDYIQELRQSNLRLSEELQNLDQLQMDNEVLRQQVEDLKNNNLTLRTQLRHHGVEIIIKSDTH |
Expression
Tissue specificity
Oocyte and somatic tissue. Oocytic and somatic forms of this protein exist, probably as a result of post-translational modifications or minor splicing differences.
Developmental stage
In the oocyte, the protein accumulates from stage 1 to stage 5/6 of oogenesis and persists through gastrulation while the somatic protein begins to accumulate at early cleavage and, by the neurula stage, is the dominant, if not exclusive, form present.
Interaction
Subunit
Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a homodimer or a heterodimer.
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 104-131 | Disordered | ||||
Sequence: DDNGETDASGPETHYTYFPTDSSTSVGG | ||||||
Region | 168-207 | Disordered | ||||
Sequence: QGGSQRSIAPRTHPYSPKSDGPRTTRDDKRRAQHNEVERR | ||||||
Compositional bias | 187-207 | Basic and acidic residues | ||||
Sequence: DGPRTTRDDKRRAQHNEVERR | ||||||
Domain | 196-251 | bHLH | ||||
Sequence: KRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKTGQSKGGILSKACDYIQEL | ||||||
Region | 268-289 | Leucine-zipper | ||||
Sequence: LQMDNEVLRQQVEDLKNNNLTL |
Family and domain databases
Sequence
- Sequence statusComplete
- Length307
- Mass (Da)33,565
- Last updated1996-11-01 v1
- ChecksumFACA6C08F1C4CEE5
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 187-207 | Basic and acidic residues | ||||
Sequence: DGPRTTRDDKRRAQHNEVERR |