Q04669 · MOUB_ORNMO
- ProteinMoubatin
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids171 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Tick salivary platelet aggregation inhibitor that plays an important part in the anti-hemostatic strategy of ticks. Acts by scavenging thromboxane A2 (TXA2), a potent inducer of platelet aggregation and blood vessel constriction (PubMed:18694828, PubMed:8449906).
As a consequence, is a specific inhibitor of collagen-induced platelet aggregation (PubMed:8449906, PubMed:8449907).
In addition, it also acts as a potent inhibitor of TXA2-mediated vasoconstriction (PubMed:18694828).
Has also been found to bind leukotriene B4 (LTB4) (which also derives from arachidonic acid, as TXA2) with affinities in the nanomolar range (PubMed:18694828).
It does not interact with complement protein C5 (PubMed:18694828).
As a consequence, is a specific inhibitor of collagen-induced platelet aggregation (PubMed:8449906, PubMed:8449907).
In addition, it also acts as a potent inhibitor of TXA2-mediated vasoconstriction (PubMed:18694828).
Has also been found to bind leukotriene B4 (LTB4) (which also derives from arachidonic acid, as TXA2) with affinities in the nanomolar range (PubMed:18694828).
It does not interact with complement protein C5 (PubMed:18694828).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | toxin activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameMoubatin
- Alternative names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Chelicerata > Arachnida > Acari > Parasitiformes > Ixodida > Ixodoidea > Argasidae > Ornithodorinae > Ornithodoros
Accessions
- Primary accessionQ04669
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-15 | |||||
Sequence: MMLVLTTLIFSFSAS | ||||||
Chain | PRO_0000021732 | 16-171 | Moubatin | |||
Sequence: IAYAQSGCSVSDPLDALKAFKDGAGTFLLQKSTDPQARDCLKGTPNGNRDGNTLPVTMTYKDDSKWVSLNWMFTLEGANIVATLEGKRKQRGELVYDVQSHDCHITKLSSGVYQQWQSNGSADDKDIKCCDEKFKELTSGIDYTKPQEKGCETSAK | ||||||
Disulfide bond | 23↔144 | |||||
Sequence: CSVSDPLDALKAFKDGAGTFLLQKSTDPQARDCLKGTPNGNRDGNTLPVTMTYKDDSKWVSLNWMFTLEGANIVATLEGKRKQRGELVYDVQSHDCHITKLSSGVYQQWQSNGSADDKDIKC | ||||||
Disulfide bond | 55↔166 | |||||
Sequence: CLKGTPNGNRDGNTLPVTMTYKDDSKWVSLNWMFTLEGANIVATLEGKRKQRGELVYDVQSHDCHITKLSSGVYQQWQSNGSADDKDIKCCDEKFKELTSGIDYTKPQEKGC | ||||||
Disulfide bond | 118↔145 | |||||
Sequence: CHITKLSSGVYQQWQSNGSADDKDIKCC |
Post-translational modification
The N-terminus is blocked.
Keywords
- PTM
Expression
Tissue specificity
Expressed in salivary glands.
Structure
Family & Domains
Sequence similarities
Belongs to the calycin superfamily. Lipocalin family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length171
- Mass (Da)18,824
- Last updated1994-02-01 v1
- Checksum79EC7B7E460FA74B
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 54 | in Ref. 1; AA sequence | ||||
Sequence: D → DE |
Keywords
- Technical term