P83943 · DEFB1_CHILA
- ProteinBeta-defensin 1
- GeneDEFB1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Has antibacterial activity against Gram-positive bacterium S.pneumoniae Serotype 14. Is also active against Gram-negative bacteria M.catarrhalis 1857, and non-typeable H.influenzae strains 86-028NP and 1128. Has antifungal activity against C.albicans. May have a role in maintaining sterility in the middle ear (PubMed:14996845).
May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility (By similarity).
May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | membrane | |
Cellular Component | microvesicle | |
Cellular Component | sperm midpiece | |
Molecular Function | CCR6 chemokine receptor binding | |
Molecular Function | chemoattractant activity | |
Molecular Function | identical protein binding | |
Biological Process | calcium-mediated signaling | |
Biological Process | cell chemotaxis | |
Biological Process | defense response to fungus | |
Biological Process | defense response to Gram-negative bacterium | |
Biological Process | defense response to Gram-positive bacterium | |
Biological Process | killing by host of symbiont cells | |
Biological Process | positive regulation of flagellated sperm motility involved in capacitation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameBeta-defensin 1
- Short namesBD-1
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Hystricomorpha > Chinchillidae > Chinchilla
Accessions
- Primary accessionP83943
Proteomes
PTM/Processing
Features
Showing features for signal, peptide, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MRIHYLLFAVLFLFLMPVPGEG | ||||||
Peptide | PRO_0000006896 | 23-67 | Beta-defensin 1 | |||
Sequence: GIINTIQRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCRTRK | ||||||
Disulfide bond | 33↔62 | |||||
Sequence: CRVRGGRCAALTCLPRETQIGRCSVKGRKC | ||||||
Disulfide bond | 40↔55 | |||||
Sequence: CAALTCLPRETQIGRC | ||||||
Disulfide bond | 45↔63 | |||||
Sequence: CLPRETQIGRCSVKGRKCC |
Keywords
- PTM
Expression
Tissue specificity
Highly expressed in tongue, nasopharyngeal mucosa and skin, and to a lower extent in the Eustachian tube, lung and trachea.
Interaction
Subunit
Monomer. Homodimer.
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length67
- Mass (Da)7,676
- Last updated2004-06-07 v1
- Checksum30A611CDCCD5BA8D
Mass Spectrometry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY128668 EMBL· GenBank· DDBJ | AAM97293.1 EMBL· GenBank· DDBJ | mRNA |