P83056 · BRK1_BOMVA
- ProteinKininogen-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
[Ala3,Thr6]bradykinin: produces in vitro relaxation of rat arterial smooth muscle and constriction of intestinal smooth muscle. Possesses insulin-releasing activity. May target bradykinin receptors (BDKRB).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | hormone activity | |
Molecular Function | toxin activity | |
Biological Process | defense response | |
Biological Process | negative regulation of smooth muscle contraction | |
Biological Process | positive regulation of smooth muscle contraction | |
Biological Process | regulation of insulin secretion | |
Biological Process | vasodilation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameKininogen-1
- Alternative names
- Cleaved into 2 chains
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Bombinatoridae > Bombina
Accessions
- Primary accessionP83056
- Secondary accessions
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, peptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MRLWFCLSFLIILCVEHFPGTLA | ||||||
Chain | PRO_0000003437 | 24-97 | Kininogen-1 | |||
Sequence: VERNVPESEEKTEQFLRDLFEISRLQRRPAGFTPFRGKFHSQSLRGLSETKRIYNAIWPCKHCNKCKPGLLCKK | ||||||
Peptide | PRO_0000003438 | 51-59 | [Ala3,Thr6]-bradykinin | |||
Sequence: RPAGFTPFR | ||||||
Peptide | PRO_0000003439 | 76-97 | Kininogen-1-associated peptide | |||
Sequence: IYNAIWPCKHCNKCKPGLLCKK |
Keywords
- PTM
Expression
Tissue specificity
Expressed by the skin glands.
Structure
Family & Domains
Sequence similarities
Belongs to the bradykinin-related peptide family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length97
- Mass (Da)11,427
- Last updated2002-10-19 v2
- Checksum1F038BEFFF0C0908
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 95-97 | in Ref. 2; AA sequence | ||||
Sequence: CKK → AN |
Mass Spectrometry
[Ala3,Thr6]-bradykinin
Molecular mass is 1,049.31 Da. Determined by Electrospray.Kininogen-1-associated peptide
Molecular mass is 2,300 Da. Determined by Electrospray.Keywords
- Technical term