P81996 · SLB_ECHCS

Function

function

Echicetin itself inhibits aggregation of washed platelets induced by vWF, thrombin or alboaggregin-A (PubMed:11290595, PubMed:8481512).
However, when complexed with the pentameric plasma immunoglobulin Mkappa (IgMkappa), echicetin binds specifically to GPIb and activates platelets. This is caused by P-selectin expression and activation of alpha-IIb/beta-3 as well as tyrosine phosphorylation of several signal transduction molecules, including p53/56(LYN), p64, p72(SYK), p70 to p90, and p120 (PubMed:11290595).
In vivo, it induces thrombocytopenia when injected into mice (PubMed:8481512), probably accounting of activation of platelets rather than inhibition (PubMed:11290595).

Caution

The name echicetin has been given to 2 different proteins, this one from E.carinatus sochureki and another one for which the subspecies has not been specified (E.carinatus). Most experiments have been done on E.carinatus sochureki.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentextracellular region
Molecular Functionsignaling receptor activity
Molecular Functiontoxin activity

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Snaclec echicetin subunit beta

Organism names

  • Taxonomic identifier
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Lepidosauria > Squamata > Bifurcata > Unidentata > Episquamata > Toxicofera > Serpentes > Colubroidea > Viperidae > Viperinae > Echis

Accessions

  • Primary accession
    P81996

Subcellular Location

Keywords

PTM/Processing

Features

Showing features for chain, disulfide bond.

TypeIDPosition(s)Description
ChainPRO_00000467021-123Snaclec echicetin subunit beta
Disulfide bond2↔13
Disulfide bond30↔119
Disulfide bond75Interchain (with C-81 in subunit alpha)
Disulfide bond96↔111

Keywords

Expression

Tissue specificity

Expressed by the venom gland.

Interaction

Subunit

Heterodimer of subunits alpha and beta; disulfide-linked (PubMed:9163349).
Forms an active complex with the pentameric immunoglobuline Mkappa (IgMkappa) (PubMed:11290595).

Structure

Family & Domains

Features

Showing features for domain.

TypeIDPosition(s)Description
Domain1-121C-type lectin

Sequence similarities

Belongs to the snaclec family.

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    123
  • Mass (Da)
    14,869
  • Last updated
    2000-05-30 v1
  • Checksum
    C42C0AD7CDE18CA6
NCLPDWSVYEGYCYKVFKERMNWADAEKFCMKQVKDGHLVSFRNSKEVDFMISLAFPMLKMELVWIGLSDYWRDCYWEWSDGAQLDYKAWDNERHCFAAKTTDNQWMRRKCSGEFYFVCKCPA

Keywords

Sequence databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp