P17980 · PRS6A_HUMAN
- Protein26S proteasome regulatory subunit 6A
- GenePSMC3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids439 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. PSMC3 belongs to the heterohexameric ring of AAA (ATPases associated with diverse cellular activities) proteins that unfolds ubiquitinated target proteins that are concurrently translocated into a proteolytic chamber and degraded into peptides.
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | extracellular region | |
Cellular Component | ficolin-1-rich granule lumen | |
Cellular Component | membrane | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | P-body | |
Cellular Component | proteasome accessory complex | |
Cellular Component | proteasome complex | |
Cellular Component | proteasome regulatory particle, base subcomplex | |
Cellular Component | secretory granule lumen | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | identical protein binding | |
Molecular Function | proteasome-activating activity | |
Biological Process | modulation by host of viral transcription | |
Biological Process | positive regulation of proteasomal protein catabolic process | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | proteasome-mediated ubiquitin-dependent protein catabolic process |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
The subsequence YLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTE, which contains the Prot_ATP_ID_OB domain, shows transcriptional repressor activity in a high-throughput recruitment assay.
Names & Taxonomy
Protein names
- Recommended name26S proteasome regulatory subunit 6A
- Alternative names
Gene names
- Community suggested namesPSMC3
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP17980
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Involvement in disease
Deafness, cataract, impaired intellectual development, and polyneuropathy (DCIDP)
- Note
- DescriptionAn autosomal recessive disease characterized by early onset of deafness, cataract, severe developmental delay, and severely impaired intellectual development. Patients later develop polyneuropathy of the lower extremities, associated with depigmentation of the hair in that area.
- See alsoMIM:619354
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 334 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue, chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue | 1 | UniProt | N-acetylmethionine | ||||
Sequence: M | |||||||
Chain | PRO_0000084698 | 1-439 | UniProt | 26S proteasome regulatory subunit 6A | |||
Sequence: MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA | |||||||
Modified residue | 9 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 9 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 12 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 37 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 376 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 376 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Sumoylated by UBE2I in response to MEKK1-mediated stimuli.
Keywords
- PTM
Proteomic databases
2D gel databases
PTM databases
Expression
Interaction
Subunit
Component of the 19S proteasome regulatory particle complex. The 26S proteasome consists of a 20S core particle (CP) and two 19S regulatory subunits (RP). The regulatory particle is made of a lid composed of 9 subunits, a base containing 6 ATPases including PSMC3 and few additional components (PubMed:27342858, PubMed:27428775).
Interacts with PAAF1 (PubMed:15831487).
Interacts with PAAF1 (PubMed:15831487).
(Microbial infection) Interacts with HIV-1 Tat.
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length439
- Mass (Da)49,204
- Last updated2002-05-10 v3
- Checksum0E443465DDDEBB0B
Computationally mapped potential isoform sequences
There are 8 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 356 | in Ref. 5; BAD96205 | ||||
Sequence: M → T | ||||||
Sequence conflict | 409 | in Ref. 6; AAA36666 | ||||
Sequence: R → A |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK313518 EMBL· GenBank· DDBJ | BAG36298.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471064 EMBL· GenBank· DDBJ | EAW67916.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC008713 EMBL· GenBank· DDBJ | AAH08713.4 EMBL· GenBank· DDBJ | mRNA | ||
BC073165 EMBL· GenBank· DDBJ | AAH73165.3 EMBL· GenBank· DDBJ | mRNA | ||
BC106920 EMBL· GenBank· DDBJ | AAI06921.1 EMBL· GenBank· DDBJ | mRNA | ||
BC107804 EMBL· GenBank· DDBJ | AAI07805.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK222485 EMBL· GenBank· DDBJ | BAD96205.1 EMBL· GenBank· DDBJ | mRNA | ||
M34079 EMBL· GenBank· DDBJ | AAA36666.1 EMBL· GenBank· DDBJ | mRNA | ||
CR456731 EMBL· GenBank· DDBJ | CAG33012.1 EMBL· GenBank· DDBJ | mRNA |