P16041 · NEU3_ONCKE
- ProteinVasotocin-neurophysin VT 1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids153 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Vasotocin is an antidiuretic hormone.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | secretory granule | |
Molecular Function | neurohypophyseal hormone activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameVasotocin-neurophysin VT 1
- Cleaved into 2 chains
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Protacanthopterygii > Salmoniformes > Salmonidae > Salmoninae > Oncorhynchus
Accessions
- Primary accessionP16041
- Secondary accessions
Subcellular Location
PTM/Processing
Features
Showing features for signal, disulfide bond, peptide, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MPYSTFPLLWVLGLLALSSA | ||||||
Disulfide bond | 21↔26 | |||||
Sequence: CYIQNC | ||||||
Peptide | PRO_0000020564 | 21-29 | Vasotocin | |||
Sequence: CYIQNCPRG | ||||||
Modified residue | 29 | Glycine amide | ||||
Sequence: G | ||||||
Chain | PRO_0000020565 | 33-153 | Neurophysin VT 1 | |||
Sequence: SFPDLPRQCMSCGPGDRGRCFGPNICCGEGMGCYMGSPEAAGCVEENYLPSPCEAGGRVCGSEGSCAASGVCCDSESCVLDPDCLEDSKRQSPSEQNAALMGGLAGDLLRILHATSRGRPQ | ||||||
Disulfide bond | 41↔85 | |||||
Sequence: CMSCGPGDRGRCFGPNICCGEGMGCYMGSPEAAGCVEENYLPSPC | ||||||
Disulfide bond | 44↔58 | |||||
Sequence: CGPGDRGRCFGPNIC | ||||||
Disulfide bond | 52↔75 | |||||
Sequence: CFGPNICCGEGMGCYMGSPEAAGC | ||||||
Disulfide bond | 59↔65 | |||||
Sequence: CGEGMGC | ||||||
Disulfide bond | 92↔104 | |||||
Sequence: CGSEGSCAASGVC | ||||||
Disulfide bond | 98↔116 | |||||
Sequence: CAASGVCCDSESCVLDPDC | ||||||
Disulfide bond | 105↔110 | |||||
Sequence: CDSESC |
Post-translational modification
Seven disulfide bonds are present in neurophysin.
Keywords
- PTM
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length153
- Mass (Da)15,995
- Last updated1990-04-01 v1
- ChecksumA67C051358E4D5A9
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 7 | in Ref. 2; BAA01736 | ||||
Sequence: P → Q |