P0DH68 · Y3132_SELML
- ProteinSCA7 domain-containing protein SELMODRAFT_431321
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids265 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | SAGA complex |
Names & Taxonomy
Protein names
- Recommended nameSCA7 domain-containing protein SELMODRAFT_431321
Gene names
Organism names
- Taxonomic lineage
Accessions
- Primary accessionP0DH68
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MWFFLSSLCPVVAERCRS | ||||||
Chain | PRO_0000412057 | 19-265 | SCA7 domain-containing protein SELMODRAFT_431321 | |||
Sequence: LLVPEDSGVDVENGGKRTIPRSRNGMLGEDMDDAAPLDSGVSMSDMQMGSFSTLKAVKRAEVGGTGPKVGRPRKLSVYNPREMSDGNPGEDCLVAGPSAVSHSEGLSSSGKRRKQHLPFTVDDLDIMCGVPSPRSGAPCRQPLTCKSHSISSKRAVTGRRKPFDALLQDFKDNNSRKSQQADIPRPLATKVYCSGHSQRMRAVITSLYRESISGRSSLPQNEQTLALDANPQQQQQQHALMSLNKVS |
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 81-105 | Disordered | ||||
Sequence: GGTGPKVGRPRKLSVYNPREMSDGN | ||||||
Domain | 133-200 | SCA7 | ||||
Sequence: QHLPFTVDDLDIMCGVPSPRSGAPCRQPLTCKSHSISSKRAVTGRRKPFDALLQDFKDNNSRKSQQAD |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length265
- Mass (Da)28,815
- Last updated2011-07-27 v1
- ChecksumA497B9BB0FBFADD0
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GL377715 EMBL· GenBank· DDBJ | EFJ05737.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. |