O76808 · SUH_CIOIN
- ProteinSuppressor of hairless homolog
- GeneSu(H)
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids554 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some Notch protein, it acts as a transcriptional activator that activates transcription of Notch target genes (By similarity).
Required for the transcriptional expression of Brachyury, suggesting that it participates in notochord differentiation
Required for the transcriptional expression of Brachyury, suggesting that it participates in notochord differentiation
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 83-90 | |||||
Sequence: KSYGNEKR | ||||||
DNA binding | 218-227 | |||||
Sequence: RLRSQTVSTR | ||||||
DNA binding | 291-323 | |||||
Sequence: RKVDKQTAILDADDPVSQLHKCAFYLKDTERMY |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription activator activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | Notch signaling pathway |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSuppressor of hairless homolog
- Short namesSu(H)
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Tunicata > Ascidiacea > Phlebobranchia > Cionidae > Ciona
Accessions
- Primary accessionO76808
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000208574 | 1-554 | Suppressor of hairless homolog | |||
Sequence: MYHPHHLPAHGQVQSHQHREDAAATSSRDVNGGLSVTESAIASFRSLREKYPPKKLTRDAMRRYLKDPNDQTLIVLHAKVAQKSYGNEKRFFCPPPCMYLLGNGWKRKQQILEEEEGSSEAGQLHAFIGIGSSEQEMQQLHLDGKNFCTAKTLYISDTDKRKHFMLNVKMFFGGGGADVGQFSSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEKGNFHASSIQWGCFAIHLLDDDESESEEFSVVDGYIHYGQTVKLVCSNTGMALPRLIIRKVDKQTAILDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKETNKEMINDGASWTIISTDKAEYTFCDGMGPTADPVTPVPNVHSLQLNGGGDVAMLEVNGECFTSNLKVWFGEIEADTMFRCAEGLLCVVPDISAFREGWKWVKESVQVPINLVRNDGVIYPTNLTFTFTPEPGPRQHCPAALNILHGSKRPSASMPPTPVSGSEDDSGRGNESDRGDPIMPIKRPALDVHGRPVAPEAAATMNGANMLRTAS |
Interaction
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-31 | Disordered | ||||
Sequence: MYHPHHLPAHGQVQSHQHREDAAATSSRDVN | ||||||
Domain | 381-471 | IPT/TIG | ||||
Sequence: PNVHSLQLNGGGDVAMLEVNGECFTSNLKVWFGEIEADTMFRCAEGLLCVVPDISAFREGWKWVKESVQVPINLVRNDGVIYPTNLTFTFT | ||||||
Region | 489-554 | Disordered | ||||
Sequence: GSKRPSASMPPTPVSGSEDDSGRGNESDRGDPIMPIKRPALDVHGRPVAPEAAATMNGANMLRTAS | ||||||
Compositional bias | 509-523 | Basic and acidic residues | ||||
Sequence: SGRGNESDRGDPIMP |
Sequence similarities
Belongs to the Su(H) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length554
- Mass (Da)61,389
- Last updated1998-11-01 v1
- ChecksumE7F93BBA2A3D6666
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 509-523 | Basic and acidic residues | ||||
Sequence: SGRGNESDRGDPIMP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF085173 EMBL· GenBank· DDBJ | AAC34125.1 EMBL· GenBank· DDBJ | mRNA |