N4VG36 · NIS1_COLOR
- ProteinNecrosis-inducing secreted protein 1
- GeneNIS1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids162 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Secreted effector that induces necrotic lesions in Nicotiana benthamiana (PubMed:22352720).
Interacts with the host receptor-like kinases (RLKs) BAK1/SERK3 and BKK1/SERK4, inhibits their kinase activity and suppresses INF1-induced pathogen-associated molecular pattern (PAMP)-triggered immunity (PTI) in N.benthamiana (PubMed:30584105).
Also interacts with the host receptor-like cytoplasmic kinase (RLCK) BIK1 and inhibits its kinase activity, thereby inhibiting PAMP-induced ROS generation (PubMed:30584105).
In PTI, phosphorylation relaying by RLKs and RLCKs is critical for the initiation of downstream signaling (PubMed:30584105).
Interacts with the host receptor-like kinases (RLKs) BAK1/SERK3 and BKK1/SERK4, inhibits their kinase activity and suppresses INF1-induced pathogen-associated molecular pattern (PAMP)-triggered immunity (PTI) in N.benthamiana (PubMed:30584105).
Also interacts with the host receptor-like cytoplasmic kinase (RLCK) BIK1 and inhibits its kinase activity, thereby inhibiting PAMP-induced ROS generation (PubMed:30584105).
In PTI, phosphorylation relaying by RLKs and RLCKs is critical for the initiation of downstream signaling (PubMed:30584105).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | host cell cytoplasm |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNecrosis-inducing secreted protein 1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Sordariomycetes > Hypocreomycetidae > Glomerellales > Glomerellaceae > Colletotrichum > Colletotrichum orbiculare species complex
Accessions
- Primary accessionN4VG36
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Secreted, via the endoplasmic reticulum-to-Golgi route and subsequent exocytosis, and accumulates in a ring-like region around the neck of the biotrophic primary hyphae at the pathogen-plant interface.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 125 | Specifically reduces the interaction with N.benthamiana SERK3 and its paralogs but not Arabidopsis BAK1. | ||||
Sequence: Y → A |
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MQFLTSLAAAASLVSLASA | ||||||
Chain | PRO_5004123125 | 20-162 | Necrosis-inducing secreted protein 1 | |||
Sequence: RISGIALPQTVKAGDNINAIVVTEGYIQSVQDIAIAFGVAPAASAYPGTLSTLLGSFYLGPEQSNVQNNITEPITIPESLVPGEYVIAASLFSLYGASSSPTVSNYNVTVNVGNETSTTYVRSQFYVGNSNSTVCLGGYTRKI | ||||||
Glycosylation | 88 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 126 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 133 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 150 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
PTM databases
Expression
Induction
Preferentially expressed in biotrophic invasive hyphae at the post-invasive stage.
Interaction
Subunit
Interacts with the host pattern recognition receptor (PRR)-associated kinases BAK1/SERK3, BKK1/SERK4 and BIK1.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 103-132 | BAK1/SERK3-binding | ||||
Sequence: EYVIAASLFSLYGASSSPTVSNYNVTVNVG |
Domain
The C-terminal region from residues 103 to 132 is important for BAK1/SERK3-binding and the host cell death suppression.
Sequence similarities
Belongs to the NIS1 effector family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length162
- Mass (Da)16,796
- Last updated2013-06-26 v1
- ChecksumDCC17B3BE1DBF39B
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB669517 EMBL· GenBank· DDBJ | BAL70334.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KB725990 EMBL· GenBank· DDBJ | ENH80006.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AMCV02000002 EMBL· GenBank· DDBJ | TDZ25263.1 EMBL· GenBank· DDBJ | Genomic DNA |