L7NCR1 · NLP6_PHYCP
- ProteinNLP effector protein 6
- GeneNLP6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids338 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Secreted effector that contributes strongly to virulence during infection by P.capsici. Causes large necrotic areas in both host C.annuum and non-host N.benthamiana.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNLP effector protein 6
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Sar > Stramenopiles > Oomycota > Peronosporales > Peronosporaceae > Phytophthora
Accessions
- Primary accessionL7NCR1
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MRFTTIFWISLTVLATVRA | ||||||
Chain | PRO_5003982510 | 20-338 | NLP effector protein 6 | |||
Sequence: EDGSHAQNEVQAGDGSHVQNEVQVGSEPQTQDSIETPKPTIKYIDFGDLTLSPSASSPAKRNVTLPPDTTMRPDPRQTEPPTEAPTPASTPAPTPDPGPWVDKWIGHDQVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETGGGLKTTGKSRGNCGGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDSPSPKMGHRHDWEHAIVFIDNPEVSEPKILACSVSSHDGYKKYNPCPSWVIDGTSLKVRYKHAWPLNHDLDATGDGGKFQDSIMWNQLTEDARRALNSVSFGKANTPFNDGKFMPKIENAWPF | ||||||
Glycosylation | 81 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
PTM databases
Expression
Induction
Expression reached the highest levels at 3 days after inoculation of pepper leaves, followed by a gradual decline.
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 68-119 | Disordered | ||||
Sequence: LTLSPSASSPAKRNVTLPPDTTMRPDPRQTEPPTEAPTPASTPAPTPDPGPW | ||||||
Compositional bias | 69-83 | Polar residues | ||||
Sequence: TLSPSASSPAKRNVT | ||||||
Compositional bias | 97-117 | Pro residues | ||||
Sequence: TEPPTEAPTPASTPAPTPDPG | ||||||
Motif | 205-215 | Conserved undecapeptide motif I | ||||
Sequence: AIMYSWYFPKD | ||||||
Motif | 222-227 | Hepta-peptide GHRHDWE motif II | ||||
Sequence: GHRHDW |
Domain
Key residues/motif important for the effector activities are degenerated in most NLPs, including the nlp24 peptide consisting of the conserved region I (11-aa immunogenic part) and conserved region II (the heptapeptide GHRHDWE motif) that is important for phytotoxic activity.
Sequence similarities
Belongs to the Necrosis inducing protein (NPP1) family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length338
- Mass (Da)37,326
- Last updated2013-04-03 v1
- ChecksumF9A91B6B7C1C082D
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 69-83 | Polar residues | ||||
Sequence: TLSPSASSPAKRNVT | ||||||
Compositional bias | 97-117 | Pro residues | ||||
Sequence: TEPPTEAPTPASTPAPTPDPG |