K7FSQ4 · SCNNG_PELSI
- ProteinAmiloride-sensitive sodium channel subunit gamma
- GeneSCNN1G
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids669 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apical plasma membrane | |
Cellular Component | external side of plasma membrane | |
Cellular Component | extracellular exosome | |
Cellular Component | nucleoplasm | |
Cellular Component | sodium channel complex | |
Molecular Function | ligand-gated sodium channel activity | |
Molecular Function | WW domain binding | |
Biological Process | cellular response to acidic pH | |
Biological Process | cellular response to aldosterone | |
Biological Process | intracellular sodium ion homeostasis | |
Biological Process | multicellular organismal-level water homeostasis | |
Biological Process | sodium ion import across plasma membrane | |
Biological Process | sodium ion transmembrane transport |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameAmiloride-sensitive sodium channel subunit gamma
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Testudinata > Testudines > Cryptodira > Trionychia > Trionychidae > Pelodiscus
Accessions
- Primary accessionK7FSQ4
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Apical cell membrane ; Multi-pass membrane protein
Note: Apical membrane of epithelial cells.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-67 | Cytoplasmic | ||||
Sequence: MAPPYHGDTREFSMAPAKKIKAKIKKTLPVTGPQAPTVSELMHWYCMNTNTHGCRRIVVSRGRLRKF | ||||||
Transmembrane | 68-88 | Helical; Name=1 | ||||
Sequence: IWILLTLSAVGLILWQCAELI | ||||||
Topological domain | 89-551 | Extracellular | ||||
Sequence: MSYYTASVSVTVQFQKLPFPAVTICNINPYKYSAMKEHLSELDKETKNALETLYGFSEGKSKVRRDAADWNSTGRNMQSKLLEKIPLLKFDDLFKKTATEILSGHKRKIEGSAFHQGSSMVNIGEPQDVVGFQLCDPNNSSDCAVYIFSSGVNAIQEWYKLHYMNIMAQIPLEMKVNMGYSAEDLLLTCFFDGISCDSRNFTPFHHPLYGNCYTFNSGENGTILTTSTGGSEYGLQVVLYVEEADYNPFLVTSTGAKIIVHDQDEYPFIEDIGTEIETAMATSIGMHFTRSHKLSQPYSDCTETGNDIPVANLYNKSYSLQICLHSCFQRAMVDTCGCAQYAQPLPPGAEYCNYKKYPNWMYCYYKLHEKFVKEQLGCQQICKESCSFKEWTLTTSLAQWPSSVSEDWMLRVLSWDKRQKINKMLNKTDLANLVVFYKDLNERFISENPANNLVILLSNFGGQ | ||||||
Transmembrane | 552-572 | Helical; Name=2 | ||||
Sequence: LGLWMSCSMVCVIEIIEVFFI | ||||||
Topological domain | 573-669 | Cytoplasmic | ||||
Sequence: DSFSIVMRRRWQKMKKWWNDRKAPRPQEPPQVNAPAKEGHDNPVCTDEDLPTFNTALRLPLPQENHMPRTPPPNYSTLQLNAAFTDQLPDTLEGRSH |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000432864 | 1-669 | Amiloride-sensitive sodium channel subunit gamma | |||
Sequence: MAPPYHGDTREFSMAPAKKIKAKIKKTLPVTGPQAPTVSELMHWYCMNTNTHGCRRIVVSRGRLRKFIWILLTLSAVGLILWQCAELIMSYYTASVSVTVQFQKLPFPAVTICNINPYKYSAMKEHLSELDKETKNALETLYGFSEGKSKVRRDAADWNSTGRNMQSKLLEKIPLLKFDDLFKKTATEILSGHKRKIEGSAFHQGSSMVNIGEPQDVVGFQLCDPNNSSDCAVYIFSSGVNAIQEWYKLHYMNIMAQIPLEMKVNMGYSAEDLLLTCFFDGISCDSRNFTPFHHPLYGNCYTFNSGENGTILTTSTGGSEYGLQVVLYVEEADYNPFLVTSTGAKIIVHDQDEYPFIEDIGTEIETAMATSIGMHFTRSHKLSQPYSDCTETGNDIPVANLYNKSYSLQICLHSCFQRAMVDTCGCAQYAQPLPPGAEYCNYKKYPNWMYCYYKLHEKFVKEQLGCQQICKESCSFKEWTLTTSLAQWPSSVSEDWMLRVLSWDKRQKINKMLNKTDLANLVVFYKDLNERFISENPANNLVILLSNFGGQLGLWMSCSMVCVIEIIEVFFIDSFSIVMRRRWQKMKKWWNDRKAPRPQEPPQVNAPAKEGHDNPVCTDEDLPTFNTALRLPLPQENHMPRTPPPNYSTLQLNAAFTDQLPDTLEGRSH |
Interaction
Subunit
Heterotrimer containing an alpha/SCNN1A, a beta/SCNN1B and a gamma/SCNN1G subunit. An additional delta/SCNN1D subunit exists only in some organisms and can replace the alpha/SCNN1A subunit to form an alternative channel with specific properties.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 592-619 | Disordered | ||||
Sequence: DRKAPRPQEPPQVNAPAKEGHDNPVCTD |
Sequence similarities
Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1G subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length669
- Mass (Da)76,220
- Last updated2013-01-09 v1
- Checksum945D57F08FE65870
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AGCU01105104 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AGCU01105105 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AGCU01105106 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |