G9CTS8 · G9CTS8_TAPPI
- ProteinMelanocyte-stimulating hormone receptor
- GeneMC1R
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids277 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | plasma membrane | |
Molecular Function | melanocyte-stimulating hormone receptor activity | |
Biological Process | adenylate cyclase-activating G protein-coupled receptor signaling pathway | |
Biological Process | regulation of metabolic process |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameMelanocyte-stimulating hormone receptor
- Short namesMSH-R
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Perissodactyla > Tapiridae > Tapirus
Accessions
- Primary accessionG9CTS8
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 16-35 | Helical | ||||
Sequence: LFLSLGLVSLVENVLVVAAI | ||||||
Transmembrane | 47-71 | Helical | ||||
Sequence: YFICCLAVSDLLVSVSNVLDTAILL | ||||||
Transmembrane | 91-112 | Helical | ||||
Sequence: VIDVLICGSMVSSLCFLGAIAV | ||||||
Transmembrane | 133-153 | Helical | ||||
Sequence: AWHAITAIWVASVLSSTLFIA | ||||||
Transmembrane | 159-186 | Helical | ||||
Sequence: AVLLCLVSFFVAMLALMAVLYLHMLARA | ||||||
Transmembrane | 207-234 | Helical | ||||
Sequence: FGLKGAATLTILMGIFFLCWGPFFLHLL | ||||||
Transmembrane | 254-272 | Helical | ||||
Sequence: LFLTLIICNAIIDPLIYAF |
Keywords
- Cellular component
Interaction
Subunit
Interacts with MGRN1, but does not undergo MGRN1-mediated ubiquitination; this interaction competes with GNAS-binding and thus inhibits agonist-induced cAMP production. Interacts with OPN3; the interaction results in a decrease in MC1R-mediated cAMP signaling and ultimately a decrease in melanin production in melanocytes.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 27-270 | G-protein coupled receptors family 1 profile | ||||
Sequence: ENVLVVAAITKNRNLHSPMYYFICCLAVSDLLVSVSNVLDTAILLLLEAGTLAIRASVVQQLDDVIDVLICGSMVSSLCFLGAIAVDRYISIFYALRYHSIVTLPRAWHAITAIWVASVLSSTLFIAYYNHTAVLLCLVSFFVAMLALMAVLYLHMLARACQHARGIARLHKRQHPVHQSFGLKGAATLTILMGIFFLCWGPFFLHLLLILLCPQHPTCGCVFKNFKLFLTLIICNAIIDPLIY |
Sequence similarities
Belongs to the G-protein coupled receptor 1 family.
Keywords
- Domain
Family and domain databases
Protein family/group databases
Sequence
- Sequence statusFragment
- Length277
- Mass (Da)30,753
- Last updated2012-02-22 v1
- ChecksumB65A8E8B5DDE1A0B
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: N | ||||||
Non-terminal residue | 277 | |||||
Sequence: L |