G9CI93 · G9CI93_PETIN
- ProteinSKP1-like protein
- GeneSSK1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids179 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends on the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1.
Pathway
Protein modification; protein ubiquitination.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | cullin family protein binding | |
Biological Process | jasmonic acid mediated signaling pathway | |
Biological Process | protein ubiquitination | |
Biological Process | SCF-dependent proteasomal ubiquitin-dependent protein catabolic process |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSKP1-like protein
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Solanales > Solanaceae > Petunioideae > Petunia
Accessions
- Primary accessionG9CI93
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Subunit
Part of a SCF (SKP1-cullin-F-box) protein ligase complex.
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 6-64 | SKP1 component POZ | ||||
Sequence: KMVTLKSNDDQEFQVEEAAVIQSEMLKNMIEDDCASSVIPLPNIDSKTLSKVIEYLNKH | ||||||
Region | 65-92 | Disordered | ||||
Sequence: ITRDEDEDEEQEESEDKGKEVDTGEEDD | ||||||
Compositional bias | 70-92 | Acidic residues | ||||
Sequence: DEDEEQEESEDKGKEVDTGEEDD | ||||||
Domain | 122-168 | SKP1 component dimerisation | ||||
Sequence: ELMELCCQSAADRLKNKSVRAVREMLKITNDLTEEEEQEIINDAPWA |
Sequence similarities
Belongs to the SKP1 family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length179
- Mass (Da)20,558
- Last updated2012-02-22 v1
- Checksum3A9F0BAA347D2BB1
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 70-92 | Acidic residues | ||||
Sequence: DEDEEQEESEDKGKEVDTGEEDD |