E1CAN4 · E1CAN4_9STRA
- ProteinRibulose-1,5-bisphosphate carboxylase/oxygenase large subunit
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids183 (go to sequence)
- Protein existencePredicted
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | membrane | |
Molecular Function | magnesium ion binding | |
Molecular Function | ribulose-bisphosphate carboxylase activity |
Names & Taxonomy
Protein names
- Submitted names
Encoded on
- Chloroplast
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Sar > Stramenopiles > Ochrophyta > Raphidophyceae > Chattonellales > Chattonellaceae > Chattonella
Accessions
- Primary accessionE1CAN4
Subcellular Location
UniProt Annotation
GO Annotation
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 28-48 | Helical | ||||
Sequence: YAKAVGSVIIMIDLVIGYTAI |
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-183 | Ribulose bisphosphate carboxylase large subunit C-terminal | ||||
Sequence: ASGEVKGSYLNCTAATMEEMYERADYAKAVGSVIIMIDLVIGYTAIQSMAIWSRKNDMILHLHRAGNSTYARQKNHGINFRVICKWMRMAGVDHIHAGTVVGKLEGDPLMVKGFYDTLRDTELSVNLPQGIFFEMDWASLRKCCPVASGGIHCGQMHQLLYYLGDDVVLQFGGGTIGHPDG |
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length183
- Mass (Da)20,117
- Last updated2010-11-30 v1
- Checksum7E3A1666700F032F
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: S | ||||||
Non-terminal residue | 183 | |||||
Sequence: G |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB334409 EMBL· GenBank· DDBJ | BAJ11820.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334410 EMBL· GenBank· DDBJ | BAJ11821.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334411 EMBL· GenBank· DDBJ | BAJ11822.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334412 EMBL· GenBank· DDBJ | BAJ11823.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334413 EMBL· GenBank· DDBJ | BAJ11824.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334414 EMBL· GenBank· DDBJ | BAJ11825.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334415 EMBL· GenBank· DDBJ | BAJ11826.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334416 EMBL· GenBank· DDBJ | BAJ11827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334418 EMBL· GenBank· DDBJ | BAJ11829.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334419 EMBL· GenBank· DDBJ | BAJ11830.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334420 EMBL· GenBank· DDBJ | BAJ11831.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334421 EMBL· GenBank· DDBJ | BAJ11832.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334422 EMBL· GenBank· DDBJ | BAJ11833.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334423 EMBL· GenBank· DDBJ | BAJ11834.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334424 EMBL· GenBank· DDBJ | BAJ11835.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334425 EMBL· GenBank· DDBJ | BAJ11836.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334426 EMBL· GenBank· DDBJ | BAJ11837.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334427 EMBL· GenBank· DDBJ | BAJ11838.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334428 EMBL· GenBank· DDBJ | BAJ11839.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB334429 EMBL· GenBank· DDBJ | BAJ11840.1 EMBL· GenBank· DDBJ | Genomic DNA |