E1ACR3 · NOTR_ASPSM
- ProteinNotoamide biosynthesis cluster transcriptional coactivator notR
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids460 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
function
Transcription factor that probably regulates the expression of the gene cluster that mediates the biosynthesis of notoamide, a fungal indole alkaloid that belongs to a family of natural products containing a characteristic bicyclo[2.2.2]diazaoctane core.
Biotechnology
Notoamides have been shown to exhibit antitumoral activities (PubMed:17304611).
Notoamides A-C show moderate cytotoxicity against HeLa and L1210 cells with IC50 values in the range of 22-52 mg/ml, but the IC50 value of notoamide D is greater than 100 mg/ml (PubMed:17304611).
Moreover, notoamide C induces G2/M-cell cycle arrest at a concentration of 6.3 mg/ml (PubMed:17304611).
Notoamides A-C show moderate cytotoxicity against HeLa and L1210 cells with IC50 values in the range of 22-52 mg/ml, but the IC50 value of notoamide D is greater than 100 mg/ml (PubMed:17304611).
Moreover, notoamide C induces G2/M-cell cycle arrest at a concentration of 6.3 mg/ml (PubMed:17304611).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 107-126 | H-T-H motif | ||||
Sequence: IQDLADLAGVPDIQLRRVIR |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | methyltransferase activity |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNotoamide biosynthesis cluster transcriptional coactivator notR
- Alternative names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Eurotiomycetes > Eurotiomycetidae > Eurotiales > Aspergillaceae > Aspergillus
Accessions
- Primary accessionE1ACR3
Subcellular Location
Phenotypes & Variants
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000448821 | 1-460 | Notoamide biosynthesis cluster transcriptional coactivator notR | |||
Sequence: MPGIAMDGLSKLEAESERLTATIKSYVRHRRDVESSDQLRASPDANMEASRTKSVILASIANIKALLGGPVELLQDLARQVEIVACLRWLAEYQILACIPAEGGMSIQDLADLAGVPDIQLRRVIRLVGTSGFLQEPMPNYVSHTPLSAQFVTNQSWLDAAVFMAELAAPTALHMPAATHRFGGSRHPTETAYNLALNSLQPFGAAIQERPKLGRQWSAYLHHAVGLHQEKKIADMLSQLKWSSLGNSFVVEVGAQSTSMAHHLANKFPTLHLIVQIDRSRASRLNPDYLWPGEMMNGLTRDFTPQPESSPRPGSASSRVTVTYRSASMPQPVVDAAVYILHVPVLSTNSPAGADAMETVKTELQDYLGILRATAGILLIPTANLLPEPGSLSDPNFEAVARTRDLNYLQLANEGEMEMTDLFSAIETTRDGLGRLVITNQLRSHIGLTVCLTLKHETYC |
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 74-145 | HTH iclR-type | ||||
Sequence: LQDLARQVEIVACLRWLAEYQILACIPAEGGMSIQDLADLAGVPDIQLRRVIRLVGTSGFLQEPMPNYVSHT | ||||||
Region | 300-320 | Disordered | ||||
Sequence: TRDFTPQPESSPRPGSASSRV | ||||||
Compositional bias | 302-320 | Polar residues | ||||
Sequence: DFTPQPESSPRPGSASSRV |
Family and domain databases
Sequence
- Sequence statusComplete
- Length460
- Mass (Da)50,244
- Last updated2010-11-02 v1
- Checksum52237E56FCFE6BD4
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 302-320 | Polar residues | ||||
Sequence: DFTPQPESSPRPGSASSRV |