D2CZZ9 · BNM2C_BRANA
- ProteinBURP domain-containing protein BNM2C
- GeneBNM2C
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids281 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | protein storage vacuole |
Names & Taxonomy
Protein names
- Recommended nameBURP domain-containing protein BNM2C
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Brassiceae > Brassica
Accessions
- Primary accessionD2CZZ9
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MASLRFSVTFPALFSLLLSLWVVDA | ||||||
Chain | PRO_5005908045 | 26-281 | BURP domain-containing protein BNM2C | |||
Sequence: CTSRKLISNNEQEGQNISHLFKDGEFEDPTMYMFFKISDLKLGTKLPIYFNKNDLRKVPPLLTRQEADLIPFSESNLDFLLNHFSISKDSPQGEAMKETLQRCDFKAIEGEYKFCGTSLESMLDLAKKTIASNADLKVMTTKVMVPDQNRISYALHNYTFAEVPKELDGIKVLGCHRMPYPYVVYYCHGHKSGTKVFEVNLMSDDGIQLVVGPAVCHMDTSMWNADHVAFKVLKIEPRSAPVCHFFPLDNIVWVSK |
Proteomic databases
Expression
Tissue specificity
Expressed in the radicle of germinating seeds 2 days post-imbibition (DPI) and in roots of 30-DPI young plants. Expressed in the embryo and seed coat tissues of developing seeds. The protein accumulates only in seeds and only long after transcript accumulation becomes evident.
Developmental stage
Peak of expression in seeds between 3 and 28 days post-anthesis.
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 59-281 | BURP | ||||
Sequence: FFKISDLKLGTKLPIYFNKNDLRKVPPLLTRQEADLIPFSESNLDFLLNHFSISKDSPQGEAMKETLQRCDFKAIEGEYKFCGTSLESMLDLAKKTIASNADLKVMTTKVMVPDQNRISYALHNYTFAEVPKELDGIKVLGCHRMPYPYVVYYCHGHKSGTKVFEVNLMSDDGIQLVVGPAVCHMDTSMWNADHVAFKVLKIEPRSAPVCHFFPLDNIVWVSK |
Domain
The BURP domain located at the C-terminus has not been identified in non-plant proteins.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length281
- Mass (Da)31,937
- Last updated2010-02-09 v1
- ChecksumB3EE8A788CB7DC16
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FJ204001 EMBL· GenBank· DDBJ | ACO54862.1 EMBL· GenBank· DDBJ | mRNA | ||
FJ204002 EMBL· GenBank· DDBJ | ACO54863.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LK031810 EMBL· GenBank· DDBJ | CDX77253.1 EMBL· GenBank· DDBJ | Genomic DNA |