D0LDS6 · ARC_GORB4
- ProteinProteasome-associated ATPase
- Genearc
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids607 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
ATPase which is responsible for recognizing, binding, unfolding and translocation of pupylated proteins into the bacterial 20S proteasome core particle. May be essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase may function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis.
Pathway
Protein degradation; proteasomal Pup-dependent pathway.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | proteasome complex | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Biological Process | modification-dependent protein catabolic process | |
Biological Process | proteasomal protein catabolic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProteasome-associated ATPase
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Actinomycetota > Actinomycetes > Mycobacteriales > Gordoniaceae > Gordonia
Accessions
- Primary accessionD0LDS6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000396986 | 1-607 | Proteasome-associated ATPase | |||
Sequence: MTESDRHDTPKGDRRISEGAGASPDESNPTDFAPEEFTPAYTPPLARSGTERPSFGRPAADNKELQERVDNLTARNAKLLDTLKDARQQLVALREEVDRLGQPPSGYGVLLEVQPDATVDVFTSGRKMRLTCSPNIDTETLHKGQTLRLNEALTIVEACEFDTVGEISTLREVLGDGKRALVVGHADEERVVHLAEPLLGEVDGEDGKRRRLRPGDSLLIDTKAGFAFERVPKAEVEDLVLEEVPDVGYEDIGGLGRQIEQIRDAVELPFLHKDLFRDYALRPPKGVLLYGPPGCGKTLIAKAVANSLAKKIAQARGDDAKEAKSYFLNIKGPELLNKFVGETERHIRLIFQRAREKASEGTPVIVFFDEMDSIFRTRGSGVSSDVETTVVPQLLSEIDGVEGLENVIVIGASNREDMIDPAILRPGRLDVKIKIERPDAEAAMDIFSKYLVETLPVHADDLNEFGGDRTACINAMIERVVERMYAESDDNRFLEVTYANGDKEIMYFKDFNSGAMIQNVVDRSKKYAIKSQLETGAPGLRVQHLFDSILDEFAENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKSSGASRAIDTETNTGQYL |
Interaction
Subunit
Homohexamer. Assembles into a hexameric ring structure that caps the 20S proteasome core. Strongly interacts with the prokaryotic ubiquitin-like protein Pup through a hydrophobic interface; the interacting region of ARC lies in its N-terminal coiled-coil domain. There is one Pup binding site per ARC hexamer ring. Upon ATP-binding, the C-terminus of ARC interacts with the alpha-rings of the proteasome core, possibly by binding to the intersubunit pockets.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-20 | Basic and acidic residues | ||||
Sequence: MTESDRHDTPKGDRRISEGA | ||||||
Region | 1-65 | Disordered | ||||
Sequence: MTESDRHDTPKGDRRISEGAGASPDESNPTDFAPEEFTPAYTPPLARSGTERPSFGRPAADNKEL | ||||||
Coiled coil | 59-102 | |||||
Sequence: AADNKELQERVDNLTARNAKLLDTLKDARQQLVALREEVDRLGQ | ||||||
Region | 606-607 | Docks into pockets in the proteasome alpha-ring | ||||
Sequence: YL |
Domain
Consists of three main regions, an N-terminal coiled-coil domain that binds to protein Pup and functions as a docking station, an interdomain involved in ARC hexamerization, and a C-terminal ATPase domain of the AAA type.
Sequence similarities
Belongs to the AAA ATPase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length607
- Mass (Da)67,157
- Last updated2009-12-15 v1
- ChecksumADD51BB93C7A9865
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-20 | Basic and acidic residues | ||||
Sequence: MTESDRHDTPKGDRRISEGA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP001802 EMBL· GenBank· DDBJ | ACY21699.1 EMBL· GenBank· DDBJ | Genomic DNA |