C9ZN16 · FAZ1_TRYB9
- ProteinFlagellar attachment zone protein 1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1748 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
A component of FAZ filament that is required for correct FAZ assembly and attachment. Not essential for new flagellum growth (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoskeleton | |
Cellular Component | motile cilium |
Names & Taxonomy
Protein names
- Recommended nameFlagellar attachment zone protein 1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Discoba > Euglenozoa > Kinetoplastea > Metakinetoplastina > Trypanosomatida > Trypanosomatidae > Trypanosoma
Accessions
- Primary accessionC9ZN16
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000414607 | 1-1748 | Flagellar attachment zone protein 1 | |||
Sequence: MALLNVISENPLTLQPGQVIAFDHLANGEHWQWALGTVVSSDKHVVVVEQWAVNEGSCETLKHNISSEIQKEMKRMGVFQEQLSSARDKLAAIRSENEDRVSAARAVFEDAKARVASVDEVHMREVTSQACPSPVAVEVLKCVLALAQNDPTVTNCSTWDDIRMEYRRPNAIADFISADITGKTYPNAEEICSSLNEQRLSSLAASRDSEAISSLHHWVLSALAYQEAYCRLTTDTRVQEQNDAIANCIAGMKGCRLKVMKLKEELERGGTPTFGGQLTSFTKTSVQLKAPLSSVISIVGVDPSAQDCVLTDDEVGLILDKAEQTRLQINDHFSHLSNSYMEAMAELHCLSMYTSELEERRLNLQERFVFSLFTNAGKTNAPRRERIETDVGLRSVEAPRGDSANNIKDLQEIIKELSSHDERWMYRNEPTVTTKHRKSYPGREWSKVVERKPEELLSTFRTEQAAACHVPEDAIRNIEFTATSEKLQVSFDVQHPVKQTAAEINKRLQEFPSRGMDRMLCDVDQPKKGLDRAIVEVCRAFDLREHAFRGMTFDKFIEEVAMKGRVGDKDAYESEIGDLLMLLDKIHNENRSLQYTLEKSAEEFRRQTASTMREQESLRQRNGELHAEIGRLRDLVEKLRDLADNQASELELLKLQKTQANQIRAQRNLSTFRGDDTAEPVYCVTLDELREQTEHCDQVERELERQREQCQNLLNAQDDLLAELSGVSEEKEKLEAECERLEAELRQMEEKSRLSEQGLSEMTQRLEEKQAEIEGLLENLEQLDEQLEALRAAEKSAQAHIEARDREISDLQQRLEGEIDDHIKTTALLEELRKHYNNLEELFDKQEAELMAYREKRQNAHKVRSLEPTLRPIGTQTKPFQEVVSADEISSEPLLSVTLDEYNDHMHRSNQFQQENDLLRQQLQQANDERENLHDRLEQLMAENQSLSEQLHNMHEELEREERDRSGVTLQNERLAEEIQRKTAENEQLVLENNKSRSDIRNLNVQVQRLMEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEALDLKAAENEKLAEELELKVAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEALDLKAAENEKLAEELDLKAAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKVAENEKLAEELELKVAENEKLAEELELKVAENKRLAEEVTQRLSEKELLAEDTSARLLEADSANSALQCKVKHLEEKLTLLSSEKETALATLEAEIVDLLTQLKGLNGTNSALESLCASKEKELVFLREHCELWTDPTTKKEKVITRHVKVFDGNEWMKLITDRPEALMSAFVIDAGNACHVPGDQIHEVSFLNNKEKH |
Structure
Family & Domains
Features
Showing features for coiled coil, repeat, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 613-657 | |||||
Sequence: REQESLRQRNGELHAEIGRLRDLVEKLRDLADNQASELELLKLQK | ||||||
Coiled coil | 684-864 | |||||
Sequence: VTLDELREQTEHCDQVERELERQREQCQNLLNAQDDLLAELSGVSEEKEKLEAECERLEAELRQMEEKSRLSEQGLSEMTQRLEEKQAEIEGLLENLEQLDEQLEALRAAEKSAQAHIEARDREISDLQQRLEGEIDDHIKTTALLEELRKHYNNLEELFDKQEAELMAYREKRQNAHKVR | ||||||
Coiled coil | 903-1663 | |||||
Sequence: NDHMHRSNQFQQENDLLRQQLQQANDERENLHDRLEQLMAENQSLSEQLHNMHEELEREERDRSGVTLQNERLAEEIQRKTAENEQLVLENNKSRSDIRNLNVQVQRLMEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEALDLKAAENEKLAEELELKVAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEALDLKAAENEKLAEELDLKAAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKVAENEKLAEELELKVAENEKLAEELELKVAENKRLAEEVTQRLSEKELLAEDTSARLLEADSANSALQCKVKHLEEKLTLLSSEKETALATLEAEIVDLLTQLKGLNGTNSALE | ||||||
Repeat | 1012-1025 | 1 | ||||
Sequence: EELELKAAENEKLA | ||||||
Region | 1012-1529 | 41 X 14 AA tandem repeats of E-E-L-E-L-K-[VA]-A-E-N-E-K-L-A | ||||
Sequence: EELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEALDLKAAENEKLAEELELKVAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEALDLKAAENEKLAEELDLKAAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLA | ||||||
Repeat | 1026-1039 | 2 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1040-1053 | 3 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1054-1067 | 4 | ||||
Sequence: EALDLKAAENEKLA | ||||||
Repeat | 1068-1081 | 5 | ||||
Sequence: EELELKVAENEKLA | ||||||
Repeat | 1082-1095 | 6 | ||||
Sequence: EELELKVAENEKLA | ||||||
Repeat | 1096-1109 | 7 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1110-1123 | 8 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1124-1137 | 9 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1138-1151 | 10 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1152-1165 | 11 | ||||
Sequence: EALDLKAAENEKLA | ||||||
Repeat | 1166-1179 | 12 | ||||
Sequence: EELDLKAAENEKLA | ||||||
Repeat | 1180-1193 | 13 | ||||
Sequence: EELELKVAENEKLA | ||||||
Repeat | 1194-1207 | 14 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1208-1221 | 15 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1222-1235 | 16 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1236-1249 | 17 | ||||
Sequence: EELELKVAENEKLA | ||||||
Repeat | 1250-1263 | 18 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1264-1277 | 19 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1278-1291 | 20 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1292-1305 | 21 | ||||
Sequence: EELELKVAENEKLA | ||||||
Repeat | 1306-1319 | 22 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1320-1333 | 23 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1334-1347 | 24 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1348-1361 | 25 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1362-1375 | 26 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1376-1389 | 27 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1390-1403 | 28 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1404-1417 | 29 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1418-1431 | 30 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1432-1445 | 31 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1446-1459 | 32 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1460-1473 | 33 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1474-1487 | 34 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1488-1501 | 35 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1502-1515 | 36 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1516-1529 | 37 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1530-1543 | 38 | ||||
Sequence: EELELKAAENEKLA | ||||||
Repeat | 1544-1557 | 39 | ||||
Sequence: EELELKVAENEKLA | ||||||
Repeat | 1558-1571 | 40 | ||||
Sequence: EELELKVAENEKLA | ||||||
Repeat | 1572-1585 | 41 | ||||
Sequence: EELELKVAENKRLA |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,748
- Mass (Da)198,586
- Last updated2009-11-24 v1
- Checksum2C157ABD0E99C125
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FN554967 EMBL· GenBank· DDBJ | CBH10670.1 EMBL· GenBank· DDBJ | Genomic DNA |