C3PNE1 · DAPF_RICAE
- ProteinDiaminopimelate epimerase
- GenedapF
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids270 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Catalyzes the stereoinversion of LL-2,6-diaminoheptanedioate (L,L-DAP) to meso-diaminoheptanedioate (meso-DAP), a precursor of L-lysine and an essential component of the bacterial peptidoglycan.
Catalytic activity
- (2S,6S)-2,6-diaminoheptanedioate = meso-2,6-diaminoheptanedioate
Pathway
Amino-acid biosynthesis; L-lysine biosynthesis via DAP pathway; DL-2,6-diaminopimelate from LL-2,6-diaminopimelate: step 1/1.
Features
Showing features for binding site, active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 15 | substrate | ||||
Sequence: N | ||||||
Binding site | 49 | substrate | ||||
Sequence: Q | ||||||
Binding site | 66 | substrate | ||||
Sequence: N | ||||||
Active site | 75 | Proton donor | ||||
Sequence: C | ||||||
Binding site | 76-77 | substrate | ||||
Sequence: GN | ||||||
Binding site | 155 | substrate | ||||
Sequence: N | ||||||
Site | 157 | Could be important to modulate the pK values of the two catalytic cysteine residues | ||||
Sequence: H | ||||||
Binding site | 187 | substrate | ||||
Sequence: N | ||||||
Site | 204 | Could be important to modulate the pK values of the two catalytic cysteine residues | ||||
Sequence: E | ||||||
Binding site | 204-205 | substrate | ||||
Sequence: ER | ||||||
Active site | 213 | Proton acceptor | ||||
Sequence: C | ||||||
Binding site | 214-215 | substrate | ||||
Sequence: GS |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | diaminopimelate epimerase activity | |
Biological Process | lysine biosynthetic process via diaminopimelate |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDiaminopimelate epimerase
- EC number
- Short namesDAP epimerase
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Alphaproteobacteria > Rickettsiales > Rickettsiaceae > Rickettsieae > Rickettsia > spotted fever group
Accessions
- Primary accessionC3PNE1
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_1000204066 | 1-270 | Diaminopimelate epimerase | |||
Sequence: MISKINFVKMHGLGNDFVIVNKRDLSSSYDLSQLAKNMAERHTGIGCDQFIIYEEHNDFYEMIIYNIDGSSAKLCGNATRCLAKLIYLDTGKQDITVMVGNKKLLCNVNDENNISVNVGSVSFNEAWMPNRDKVWEFAERYMIDLKETICVDIGNPHVVIFSKLEPQDQKIVGERLQAKELFADGVNVNFAEVKDNKIYLSVWERGAGLTLACGSGACGSFAAGLKRGFIHSPSTIVFKHGNLTMKEENGNIIMQGAATLVARGEYYCEQ |
Interaction
Subunit
Homodimer.
Structure
Sequence
- Sequence statusComplete
- Length270
- Mass (Da)30,085
- Last updated2009-06-16 v1
- Checksum78A2F36293D0FE53
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP001612 EMBL· GenBank· DDBJ | ACP53451.1 EMBL· GenBank· DDBJ | Genomic DNA |