B3RPX6 · RSSA_TRIAD
- ProteinSmall ribosomal subunit protein uS2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids286 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosolic small ribosomal subunit | |
Molecular Function | structural constituent of ribosome | |
Biological Process | cytoplasmic translation | |
Biological Process | ribosomal small subunit assembly |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameSmall ribosomal subunit protein uS2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Placozoa > Uniplacotomia > Trichoplacea > Trichoplacidae > Trichoplax
Accessions
- Primary accessionB3RPX6
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for initiator methionine, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Chain | PRO_0000371654 | 2-286 | Small ribosomal subunit protein uS2 | |||
Sequence: SGGLDILRLTADDVSKMLAASAHLGTTNVDYQMEQYVFRRRTDGVHIIDLRQTWEKLLIAARIIASIENPADVCVLSARPYGQRAVLKFAKFTGASPIAGRFTPGTFTNQIQKAYREPRLLIVTDPRVDHQPITEASYVNIPVIAFCNTDSRLRYIDVGIPCNNKGAHAIGLMWWLLAREVLRLRGTISRDTDWEHMPDLFFYRDPEEVEKEEQAQNNKWAAPEQSPALSAAVPSSAAPVEEWSSSPSKETTEWGASNTAAAAKSSWSNETGGEWGAQEGGEWGS |
Interaction
Subunit
Component of the small ribosomal subunit. Mature ribosomes consist of a small (40S) and a large (60S) subunit. The 40S subunit contains about 33 different proteins and 1 molecule of RNA (18S). The 60S subunit contains about 49 different proteins and 3 molecules of RNA (28S, 5.8S and 5S). Interacts with ribosomal protein S21.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 213-286 | Disordered | ||||
Sequence: EEQAQNNKWAAPEQSPALSAAVPSSAAPVEEWSSSPSKETTEWGASNTAAAAKSSWSNETGGEWGAQEGGEWGS | ||||||
Compositional bias | 219-233 | Polar residues | ||||
Sequence: NKWAAPEQSPALSAA | ||||||
Compositional bias | 240-274 | Polar residues | ||||
Sequence: PVEEWSSSPSKETTEWGASNTAAAAKSSWSNETGG |
Sequence similarities
Belongs to the universal ribosomal protein uS2 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length286
- Mass (Da)31,695
- Last updated2008-09-02 v1
- Checksum5FE1F2543318FD34
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 219-233 | Polar residues | ||||
Sequence: NKWAAPEQSPALSAA | ||||||
Compositional bias | 240-274 | Polar residues | ||||
Sequence: PVEEWSSSPSKETTEWGASNTAAAAKSSWSNETGG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DS985242 EMBL· GenBank· DDBJ | EDV27719.1 EMBL· GenBank· DDBJ | Genomic DNA |