B1LJT9 · MUKB_ECOSM
- ProteinChromosome partition protein MukB
- GenemukB
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1486 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Plays a central role in chromosome condensation, segregation and cell cycle progression. Functions as a homodimer, which is essential for chromosome partition. Involved in negative DNA supercoiling in vivo, and by this means organize and compact chromosomes. May achieve or facilitate chromosome segregation by condensation DNA from both sides of a centrally located replisome during cell division.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleoid | |
Molecular Function | ATP binding | |
Molecular Function | DNA binding | |
Biological Process | cell division | |
Biological Process | chromosome condensation | |
Biological Process | chromosome segregation | |
Biological Process | DNA replication |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameChromosome partition protein MukB
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Escherichia
Accessions
- Primary accessionB1LJT9
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Restricted to the nucleoid region.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_1000187476 | 1-1486 | Chromosome partition protein MukB | |||
Sequence: MIERGKFRSLTLINWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLKAGVCYSMLDTINSRHQRVVVGVRLQQVAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLSERQARVLPLNELKDKLEAMEGVQFKQFNSITDYHSLMFDLGIIARRLRSASDRSKFYRLIEASLYGGISSAITRSLRDYLLPENSGVRKAFQDMEAALRENRMTLEAIRVTQSDRDLFKHLISEATNYVAADYMRHANERRVHLDKALEFRRELHTSRQQLAAEQYKHVDMARELAEHNGAEGDLEADYQAASDHLNLVQTALRQQEKIERYEADLDELQIRLEEQNEVVAEAIERQEENEARAEAAELEVDELKSQLADYQQALDVQQTRAIQYNQAIAALNRAKELCHLPDLTADSAAEWLETFQAKELEATEKMLSLEQKMSMAQTAHSQFEQAYQLVVAINGPLARNEAWDVARELLREGVDQRHLAEQVQPLRMRLSELEQRLREQQEAERLLADFCKRQGKNFDIDELEALHQELEARIASLSDSVSNAREERMTLRQEQEQLQSRIQSLMRRAPVWLAAQNSLNQLSEQCGEEFSSSQDVTEYLQQLLEREREAIVERDEVGARKNAVDEEIERLSQPGGSEDQRLNALAERFGGVLLSEIYDDVSLEDAPYFSALYGPSRHAIVVPDLSQVTEHLEGLTDCPEDLYLIEGDPQSFDDSVFSVDELEKAVVVKIADRQWRYSRFPEVPLFGRAARESRIESLHAEREVLSERFATLSFDVQKTQRLHQAFSRFIGSHLAVAFESDPEAEIRQLNSRRVELERALSNHENDNQQQRIQFEQAKEGVTALNRILPRLNLLADDSLADRVDEIRERLDEAQEAARFVQQFGNQLAKLEPIVSVLQSDPEQFEQLKEDYAYSQQMQRDARQQAFALTEVVQRRAHFSYSDSAEMLSGNSDLNEKLRERLEQAEAERTRAREALRGHAAQLSQYNQVLASLKSSYDTKKELLNDLQRELQDIGVRADSGAEERARIRRDELHAQLSNNRSRRNQLEKALTFCEAEMDNLTRKLRKLERDYFEMREQVVTAKAGWCAVMRMVKDNGVERRLHRRELAYLSADDLRSMSDKALGALRLAVADNEHLRDVLRMSEDPKRPERKIQFFVAVYQHLRERIRQDIIRTDDPVEAIEQMEIELSRLTEELTSREQKLAISSRSVANIIRKTIQREQNRIRMLNQGLQNVSFGQVNSVRLNVNVRETHAMLLDVLSEQHEQHQDLFNSNRLTFSEALAKLYQRLNPQIDMGQRTPQTIGEELLDYRNYLEMEVEVNRGSDGWLRAESGALSTGEAIGTGMSILVMVVQSWEDESRRLRGKDISPCRLLFLDEAARLDARSIATLFELCERLQMQLIIAAPENISPEKGTTYKLVRKVFQNTEHVHVVGLRGFAPQLPETLPGSDEAPSQAS |
Interaction
Subunit
Homodimerization via its hinge domain. Binds to DNA via its C-terminal region. Interacts, and probably forms a ternary complex, with MukE and MukF via its C-terminal region. The complex formation is stimulated by calcium or magnesium. Interacts with tubulin-related protein FtsZ.
Structure
Family & Domains
Features
Showing features for coiled coil, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 326-418 | |||||
Sequence: LEADYQAASDHLNLVQTALRQQEKIERYEADLDELQIRLEEQNEVVAEAIERQEENEARAEAAELEVDELKSQLADYQQALDVQQTRAIQYNQ | ||||||
Coiled coil | 444-480 | |||||
Sequence: LETFQAKELEATEKMLSLEQKMSMAQTAHSQFEQAYQ | ||||||
Coiled coil | 509-603 | |||||
Sequence: RHLAEQVQPLRMRLSELEQRLREQQEAERLLADFCKRQGKNFDIDELEALHQELEARIASLSDSVSNAREERMTLRQEQEQLQSRIQSLMRRAPV | ||||||
Region | 666-783 | Flexible hinge | ||||
Sequence: PGGSEDQRLNALAERFGGVLLSEIYDDVSLEDAPYFSALYGPSRHAIVVPDLSQVTEHLEGLTDCPEDLYLIEGDPQSFDDSVFSVDELEKAVVVKIADRQWRYSRFPEVPLFGRAAR | ||||||
Coiled coil | 835-923 | |||||
Sequence: EAEIRQLNSRRVELERALSNHENDNQQQRIQFEQAKEGVTALNRILPRLNLLADDSLADRVDEIRERLDEAQEAARFVQQFGNQLAKLE | ||||||
Coiled coil | 977-1115 | |||||
Sequence: EMLSGNSDLNEKLRERLEQAEAERTRAREALRGHAAQLSQYNQVLASLKSSYDTKKELLNDLQRELQDIGVRADSGAEERARIRRDELHAQLSNNRSRRNQLEKALTFCEAEMDNLTRKLRKLERDYFEMREQVVTAKA | ||||||
Coiled coil | 1209-1266 | |||||
Sequence: VEAIEQMEIELSRLTEELTSREQKLAISSRSVANIIRKTIQREQNRIRMLNQGLQNVS |
Domain
The hinge domain, which separates the large intramolecular coiled coil regions, allows the homodimerization, forming a V-shaped homodimer.
Sequence similarities
Belongs to the SMC family. MukB subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,486
- Mass (Da)170,218
- Last updated2008-04-29 v1
- ChecksumB6C3B207A4C55799
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP000970 EMBL· GenBank· DDBJ | ACB15608.1 EMBL· GenBank· DDBJ | Genomic DNA |