A2DSR8 · ALG5E_TRIV3
- ProteinDolichyl-phosphate beta-glucosyltransferase ALG5E
- GeneALG5E
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids325 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Dolichyl-phosphate beta-glucosyltransferase involved in the glycosylation of glycoproteins through the synthesis of dolichyl beta-D-glucosyl phosphate which serves as a sugar donor for transfer of three glucose residues to the Man-9-GlcNAc-2-PP-dolichol precursor to N-glycans.
Catalytic activity
- a di-trans,poly-cis-dolichyl phosphate + UDP-alpha-D-glucose = a di-trans,poly-cis-dolichyl beta-D-glucosyl phosphate + UDPThis reaction proceeds in the forward direction.
a di-trans,poly-cis-dolichyl phosphate RHEA-COMP:19498 + CHEBI:58885 = a di-trans,poly-cis-dolichyl β-D-glucosyl phosphate RHEA-COMP:19502 + CHEBI:58223
Pathway
Protein modification; protein glycosylation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Molecular Function | dolichyl-phosphate beta-glucosyltransferase activity | |
Biological Process | protein N-linked glycosylation |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDolichyl-phosphate beta-glucosyltransferase ALG5E
- EC number
- Short namesDolP-glucosyltransferase
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metamonada > Parabasalia > Trichomonadida > Trichomonadidae > Trichomonas
Accessions
- Primary accessionA2DSR8
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Single-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-5 | Lumenal | ||||
Sequence: MNFWN | ||||||
Transmembrane | 6-26 | Helical | ||||
Sequence: FLEILLFIGIVAAGLIVAVMI | ||||||
Topological domain | 27-215 | Cytoplasmic | ||||
Sequence: KTAEDTTLFDRTQLPEDNPQKLNYYVQPPPNGDEKVPFPTVFEPAKVYTTFVVPAYNEEKRIPKMLDETVEYLKSREAKDKSFTWEIVVVNDGSKDKTKEVVLNYAKDYPNIFLLNQPVNMGKGAAIQAGCLHARGELVLMVDADGATKINEFEALETEIKKLMKNNNQAIVVGSRAQNEKANRTPIRK |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000431409 | 1-325 | Dolichyl-phosphate beta-glucosyltransferase ALG5E | |||
Sequence: MNFWNFLEILLFIGIVAAGLIVAVMIKTAEDTTLFDRTQLPEDNPQKLNYYVQPPPNGDEKVPFPTVFEPAKVYTTFVVPAYNEEKRIPKMLDETVEYLKSREAKDKSFTWEIVVVNDGSKDKTKEVVLNYAKDYPNIFLLNQPVNMGKGAAIQAGCLHARGELVLMVDADGATKINEFEALETEIKKLMKNNNQAIVVGSRAQNEKANRTPIRKFLGLGMHVLIVLSGVRGIHDTQCGFKLFSREACKMLFMNQHVQRWCFDPELLVIGRRLGMKISEIPVEWNEIEGSKMKISGMIKMAIDLIDIAIFHRVGAWTIRDRRINK |
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence similarities
Belongs to the glycosyltransferase 2 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length325
- Mass (Da)36,962
- Last updated2007-02-20 v1
- Checksum7161CAA46B53E407
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DS113241 EMBL· GenBank· DDBJ | EAY16467.1 EMBL· GenBank· DDBJ | Genomic DNA |