A0A7T8G5Y0 · A0A7T8G5Y0_TAMSI
- ProteinCytochrome c oxidase subunit 2
- GeneCOII
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids228 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Catalytic activity
- 4 Fe(II)-[cytochrome c] + 8 H+(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H+(out) + 2 H2OThis reaction proceeds in the forward direction.
4 RHEA-COMP:10350 + 8 H+ (in)CHEBI:15378+ CHEBI:15379 = 4 RHEA-COMP:14399 + 4 H+ (out)CHEBI:15378+ 2 CHEBI:15377
Cofactor
Note: Binds a copper A center.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | respirasome | |
Molecular Function | copper ion binding | |
Molecular Function | cytochrome-c oxidase activity | |
Biological Process | ATP synthesis coupled electron transport |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameCytochrome c oxidase subunit 2
Gene names
Encoded on
- Mitochondrion
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Sciuromorpha > Sciuridae > Xerinae > Marmotini > Tamias
Accessions
- Primary accessionA0A7T8G5Y0
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 27-46 | Helical | ||||
Sequence: TLMIVFLISSLVLYIISLML | ||||||
Transmembrane | 66-85 | Helical | ||||
Sequence: TILPAIILILIALPSLRILY |
Keywords
- Cellular component
Interaction
Subunit
Component of the cytochrome c oxidase (complex IV, CIV), a multisubunit enzyme composed of 14 subunits. The complex is composed of a catalytic core of 3 subunits MT-CO1, MT-CO2 and MT-CO3, encoded in the mitochondrial DNA, and 11 supernumerary subunits COX4I, COX5A, COX5B, COX6A, COX6B, COX6C, COX7A, COX7B, COX7C, COX8 and NDUFA4, which are encoded in the nuclear genome. The complex exists as a monomer or a dimer and forms supercomplexes (SCs) in the inner mitochondrial membrane with NADH-ubiquinone oxidoreductase (complex I, CI) and ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), resulting in different assemblies (supercomplex SCI1III2IV1 and megacomplex MCI2III2IV2) (By similarity).
Found in a complex with TMEM177, COA6, COX18, COX20, SCO1 and SCO2. Interacts with TMEM177 in a COX20-dependent manner. Interacts with COX20. Interacts with COX16
Found in a complex with TMEM177, COA6, COX18, COX20, SCO1 and SCO2. Interacts with TMEM177 in a COX20-dependent manner. Interacts with COX20. Interacts with COX16
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-91 | Cytochrome oxidase subunit II transmembrane region profile | ||||
Sequence: MAYPFELGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEIN | ||||||
Domain | 92-225 | Cytochrome oxidase subunit II copper A binding | ||||
Sequence: DPSLTVKTMGHQWYWSYEYTDYEDLNFDSYMIPTSDLNPGELRLLEVDNRMVLPMELPVRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATLISTRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFENWSSS |
Sequence similarities
Belongs to the cytochrome c oxidase subunit 2 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length228
- Mass (Da)26,104
- Last updated2021-06-02 v1
- Checksum2BAEAED53C7A244C
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 228 | |||||
Sequence: N |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
MT109552 EMBL· GenBank· DDBJ | QQP23384.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT109553 EMBL· GenBank· DDBJ | QQP23385.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT109554 EMBL· GenBank· DDBJ | QQP23386.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT109555 EMBL· GenBank· DDBJ | QQP23387.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT109556 EMBL· GenBank· DDBJ | QQP23388.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT109557 EMBL· GenBank· DDBJ | QQP23389.1 EMBL· GenBank· DDBJ | Genomic DNA |