A0A7T4XAU8 · A0A7T4XAU8_VICCR
- ProteinMaturase K
- GenematK
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids506 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Usually encoded in the trnK tRNA gene intron. Probably assists in splicing its own and other chloroplast group II introns.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Molecular Function | RNA binding | |
Biological Process | mRNA processing | |
Biological Process | RNA splicing | |
Biological Process | tRNA processing |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMaturase K
- Alternative names
Gene names
Encoded on
- Chloroplast
Organism names
- Organism
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > Hologalegina > IRL clade > Fabeae > Vicia
Accessions
- Primary accessionA0A7T4XAU8
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-332 | Maturase MatK N-terminal | ||||
Sequence: MKEYQVYLERARSRQQDFLYPLLFREYIYGLAYSHDLNRSIFVKNVGYDKKYSLLIVKRLITRMYQQNHLIISANDSNKNAFWGYNKNFYSQIISEGFAIVVEIPFFLQLSSSLEEAEIIKYYKNLRSIHSIFPFLEDKITYLNYVSDIRIPYPMHLEILVQILRYWVKDAPFFHLLRLFLYNFCNWNSLITTKKSISTFSKSNPRFFLFLYNFYVCEYESIFVFLRNKSSHLRFKSFSVFFERIFFYAKREHLVKVFSKDFSYTFTFFKDPYIHYVRYQGKCILASKNAPFLMNKWNHYFLHLWQCFFDVWSQPRMININPLSEHSFQLLG | ||||||
Domain | 360-471 | Domain X | ||||
Sequence: KKLDIIVPIIPLIRSLAKAKFCNVLGQPISKPVWADSSDFDIIDRFLRICRSLSHYYNGSSKKKSLYRIKYILRFSCIKTLACKHKSTVRAFLKRSGSEELLQEFFTEEEDL |
Sequence similarities
Belongs to the intron maturase 2 family. MatK subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length506
- Mass (Da)61,021
- Last updated2021-06-02 v1
- Checksum13E1A3CAA431AF67