A0A7S7YE53 · A0A7S7YE53_9NEIS
- ProteinEnterobactin synthase component D
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids241 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Involved in the biosynthesis of the siderophore enterobactin (enterochelin), which is a macrocyclic trimeric lactone of N-(2,3-dihydroxybenzoyl)-serine. The serine trilactone serves as a scaffolding for the three catechol functionalities that provide hexadentate coordination for the tightly ligated iron2+ atoms. Plays an essential role in the assembly of the enterobactin by catalyzing the transfer of the 4'-phosphopantetheine (Ppant) moiety from coenzyme A to the apo-domains of both EntB (ArCP domain) and EntF (PCP domain) to yield their holo-forms which make them competent for the activation of 2,3-dihydroxybenzoate (DHB) and L-serine, respectively.
Catalytic activity
- apo-[aryl-carrier protein] + CoA = holo-[aryl-carrier protein] + adenosine 3',5'-bisphosphate + H+
- apo-[peptidyl-carrier protein] + CoA = holo-[peptidyl-carrier protein] + adenosine 3',5'-bisphosphate + H+
Cofactor
Pathway
Siderophore biosynthesis; enterobactin biosynthesis.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 59 | CoA (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 67 | CoA (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 102-103 | CoA (UniProtKB | ChEBI) | ||||
Sequence: SH | ||||||
Binding site | 124 | CoA (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 124 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 125 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: I | ||||||
Binding site | 126 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 168 | CoA (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 172 | CoA (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 182 | CoA (UniProtKB | ChEBI) | ||||
Sequence: L |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | enterobactin synthetase complex | |
Molecular Function | holo-[acyl-carrier-protein] synthase activity | |
Molecular Function | magnesium ion binding | |
Biological Process | enterobactin biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEnterobactin synthase component D
- Alternative names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Betaproteobacteria > Neisseriales > Chitinibacteraceae > Chitinimonas
Accessions
- Primary accessionA0A7S7YE53
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Subunit
EntB, EntD, EntE, and EntF form a multienzyme complex called enterobactin synthase.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 52-113 | 4'-phosphopantetheinyl transferase N-terminal | ||||
Sequence: LQRAVPKRQAEYLAGRWCAARALRRFAAAEQVAVQPDRSPGWPAGFVGSISHAQGRALAVVA | ||||||
Domain | 121-210 | 4'-phosphopantetheinyl transferase | ||||
Sequence: LGVDIETELDPATAAQLEPMLLQADETALRPAGWPQARFLTLAFSAKETLYKAVYPHGRRILEFHDARLLAIGAGELELALLPDHRPATL |
Sequence similarities
Belongs to the P-Pant transferase superfamily. EntD family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length241
- Mass (Da)25,996
- Last updated2021-06-02 v1
- Checksum0F464770627E77AD