A0A7L2Q5B4 · A0A7L2Q5B4_9PASS
- Protein1-acylglycerol-3-phosphate O-acyltransferase ABHD5
- GeneAbhd5
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids217 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Coenzyme A-dependent lysophosphatidic acid acyltransferase that catalyzes the transfer of an acyl group on a lysophosphatidic acid. Functions preferentially with 1-oleoyl-lysophosphatidic acid followed by 1-palmitoyl-lysophosphatidic acid, 1-stearoyl-lysophosphatidic acid and 1-arachidonoyl-lysophosphatidic acid as lipid acceptor. Functions preferentially with arachidonoyl-CoA followed by oleoyl-CoA as acyl group donors. Functions in phosphatidic acid biosynthesis. May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2. Involved in keratinocyte differentiation. Regulates lipid droplet fusion.
Catalytic activity
- 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA = 1-(9Z)-octadecenoyl-2-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-sn-glycero-3-phosphate + CoAThis reaction proceeds in the forward direction.
- 1-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphate + (9Z)-octadecenoyl-CoA = 1-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phosphate + CoAThis reaction proceeds in the forward direction.
- 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + (9Z)-octadecenoyl-CoA = 1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphate + CoAThis reaction proceeds in the forward direction.
- 1-hexadecanoyl-sn-glycero-3-phosphate + (9Z)-octadecenoyl-CoA = 1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphate + CoAThis reaction proceeds in the forward direction.
- 1-octadecanoyl-sn-glycero-3-phosphate + (9Z)-octadecenoyl-CoA = 1-octadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphate + CoAThis reaction proceeds in the forward direction.
- eicosanoyl-CoA + 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate = 1-(9Z)-octadecenoyl-2-eicosanoyl-sn-glycero-3-phosphate + CoAThis reaction proceeds in the forward direction.
- 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + hexadecanoyl-CoA = 1-(9Z)-octadecenoyl-2-hexadecanoyl-sn-glycero-3-phosphate + CoAThis reaction proceeds in the forward direction.
- 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + octadecanoyl-CoA = 1-(9Z-octadecenoyl)-2-octadecanoyl-sn-glycero-3-phosphate + CoAThis reaction proceeds in the forward direction.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | lipid droplet | |
Cellular Component | mitochondrion | |
Molecular Function | carboxylic ester hydrolase activity | |
Molecular Function | lysophosphatidic acid acyltransferase activity | |
Biological Process | lipid homeostasis | |
Biological Process | negative regulation of sequestering of triglyceride | |
Biological Process | phosphatidic acid biosynthetic process | |
Biological Process | positive regulation of triglyceride catabolic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended name1-acylglycerol-3-phosphate O-acyltransferase ABHD5
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Neoaves > Telluraves > Australaves > Passeriformes > Sylvioidea > Zosteropidae > Hypocryptadius
Accessions
- Primary accessionA0A7L2Q5B4
Proteomes
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-200 | AB hydrolase-1 | ||||
Sequence: IEEWRKEVGLEKMILLGHNLGGFLAAAYSLKYPSRVKHLILVEPWGFPERPDNAEHERPIPIWIKALGAILSPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFDDNTVAEYIYHCNVQSPSGETAFKNMTIPYGWAKRPMLQRISQMDRDIPITVVYGARSCIDGNSGSTIQSLRPNSYVKTIAILGAGHYVYAD |
Sequence similarities
Belongs to the peptidase S33 family. ABHD4/ABHD5 subfamily.
Family and domain databases
Sequence
- Sequence statusFragment
- Length217
- Mass (Da)24,443
- Last updated2021-04-07 v1
- Checksum9F9FC96BB6DC431D
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: E | ||||||
Non-terminal residue | 217 | |||||
Sequence: D |
Keywords
- Technical term