A0A7K6NKB6 · A0A7K6NKB6_PEDTO
- ProteinPeroxisomal membrane protein PEX14
- GenePex14
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids346 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Component of the PEX13-PEX14 docking complex, a translocon channel that specifically mediates the import of peroxisomal cargo proteins bound to PEX5 receptor. The PEX13-PEX14 docking complex forms a large import pore which can be opened to a diameter of about 9 nm. Mechanistically, PEX5 receptor along with cargo proteins associates with the PEX14 subunit of the PEX13-PEX14 docking complex in the cytosol, leading to the insertion of the receptor into the organelle membrane with the concomitant translocation of the cargo into the peroxisome matrix.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | peroxisomal membrane | |
Biological Process | protein import into peroxisome matrix, docking |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended namePeroxisomal membrane protein PEX14
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Charadriiformes > Pedionomidae > Pedionomus
Accessions
- Primary accessionA0A7K6NKB6
Proteomes
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain, region, coiled coil, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-40 | Peroxisome membrane anchor protein Pex14p N-terminal | ||||
Sequence: TAVKFLQNPRVRQSPPATKRAFLKKKGLTDEEIDLAFQ | ||||||
Region | 42-64 | Disordered | ||||
Sequence: SGTSTDEPPSPGPSTQLVPTQPS | ||||||
Coiled coil | 136-163 | |||||
Sequence: LAAVQELLIQQQQKIQELTQELAASKAT | ||||||
Region | 198-346 | Disordered | ||||
Sequence: SPSAPKIPSWQIPVKPSSPSNPVVANHNSSSDISPVSNESTTSSPVKENHSPEGSKVSCHLLSTEESNKTVIDVKSQVRMEVQGEEEKRETKRNEEEEEDDEDDDVSHVDEEECLGVQTEDRRGGDGQINEQVEKLRRPEGASNENEID | ||||||
Compositional bias | 210-271 | Polar residues | ||||
Sequence: PVKPSSPSNPVVANHNSSSDISPVSNESTTSSPVKENHSPEGSKVSCHLLSTEESNKTVIDV | ||||||
Compositional bias | 276-292 | Basic and acidic residues | ||||
Sequence: RMEVQGEEEKRETKRNE | ||||||
Compositional bias | 293-307 | Acidic residues | ||||
Sequence: EEEEDDEDDDVSHVD | ||||||
Compositional bias | 308-346 | Basic and acidic residues | ||||
Sequence: EEECLGVQTEDRRGGDGQINEQVEKLRRPEGASNENEID |
Sequence similarities
Belongs to the peroxin-14 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length346
- Mass (Da)38,409
- Last updated2021-04-07 v1
- ChecksumB685641194B7114E
Features
Showing features for non-terminal residue, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: V | ||||||
Compositional bias | 210-271 | Polar residues | ||||
Sequence: PVKPSSPSNPVVANHNSSSDISPVSNESTTSSPVKENHSPEGSKVSCHLLSTEESNKTVIDV | ||||||
Compositional bias | 276-292 | Basic and acidic residues | ||||
Sequence: RMEVQGEEEKRETKRNE | ||||||
Compositional bias | 293-307 | Acidic residues | ||||
Sequence: EEEEDDEDDDVSHVD | ||||||
Compositional bias | 308-346 | Basic and acidic residues | ||||
Sequence: EEECLGVQTEDRRGGDGQINEQVEKLRRPEGASNENEID | ||||||
Non-terminal residue | 346 | |||||
Sequence: D |
Keywords
- Technical term