A0A6G7KVL7 · A0A6G7KVL7_BOROF
- ProteinPhotosystem II reaction center protein Z
- GenepsbZ
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Controls the interaction of photosystem II (PSII) cores with the light-harvesting antenna, regulates electron flow through the 2 photosystem reaction centers. PSII is a light-driven water plastoquinone oxidoreductase, using light energy to abstract electrons from H2O, generating a proton gradient subsequently used for ATP formation.
May control the interaction of photosystem II (PSII) cores with the light-harvesting antenna, regulates electron flow through the 2 photosystem reaction centers. PSII is a light-driven water plastoquinone oxidoreductase, using light energy to abstract electrons from H2O, generating a proton gradient subsequently used for ATP formation.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | photosystem II reaction center | |
Biological Process | photosynthesis | |
Biological Process | photosystem II stabilization |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended namePhotosystem II reaction center protein Z
- Short namesPSII-Z
Gene names
Encoded on
- Chloroplast
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Boraginales > Boraginaceae > Boraginoideae > Boragineae > Boragininae > Borago
Accessions
- Primary accessionA0A6G7KVL7
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Plastid, chloroplast thylakoid membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 44-61 | Helical | ||||
Sequence: TSLWVGLVFLVGILNSLI |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-28 | |||||
Sequence: MTLAFQLAVFALIATSLILLISVPVVFA | ||||||
Chain | PRO_5026079383 | 29-62 | Photosystem II reaction center protein Z | |||
Sequence: SPDGWSSNKNVVFSGTSLWVGLVFLVGILNSLIS |
Interaction
Subunit
PSII is composed of 1 copy each of membrane proteins PsbA, PsbB, PsbC, PsbD, PsbE, PsbF, PsbH, PsbI, PsbJ, PsbK, PsbL, PsbM, PsbT, PsbY, PsbZ, Psb30/Ycf12, at least 3 peripheral proteins of the oxygen-evolving complex and a large number of cofactors. It forms dimeric complexes.
Structure
Sequence
- Sequence statusComplete
- Length62
- Mass (Da)6,539
- Last updated2020-08-12 v1
- Checksum4C797B7DB28A5456