A0A650A081 · A0A650A081_PORLI
- Proteinribulose-bisphosphate carboxylase
- GenerbcL
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids240 (go to sequence)
- Protein existencePredicted
- Annotation score2/5
Function
Catalytic activity
- 2 (2R)-3-phosphoglycerate + 2 H+ = D-ribulose 1,5-bisphosphate + CO2 + H2O
- D-ribulose 1,5-bisphosphate + O2 = 2-phosphoglycolate + (2R)-3-phosphoglycerate + 2 H+
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | membrane | |
Molecular Function | magnesium ion binding | |
Molecular Function | monooxygenase activity | |
Molecular Function | ribulose-bisphosphate carboxylase activity | |
Biological Process | reductive pentose-phosphate cycle |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameribulose-bisphosphate carboxylase
- EC number
Gene names
Encoded on
- Chloroplast
Organism names
- Organism
- Taxonomic lineageEukaryota > Rhodophyta > Bangiophyceae > Bangiales > Bangiaceae > Porphyra
Accessions
- Primary accessionA0A650A081
Subcellular Location
UniProt Annotation
GO Annotation
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 66-90 | Helical | ||||
Sequence: VVGSIICMIDLVIGYTAIQSMAIWA |
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-236 | Ribulose bisphosphate carboxylase large subunit C-terminal | ||||
Sequence: KGGLDFLKDDENINSQPFMRWRERYLYSMEGVNKASAAAGEIKGHYLNVTAATMEDMYERAEFSKVVGSIICMIDLVIGYTAIQSMAIWARKNDMILHLHRAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPLMIKGFYNTLLESDTDINLPQGLFFAQNWASLRKVVPVASGGIHAGQMHQLLDYLGDDVVLQFGGGTIGHPDGIQAGATANRVALESMVMA |
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length240
- Mass (Da)26,509
- Last updated2020-04-22 v1
- Checksum7B9C691545ECC1A4
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: K | ||||||
Non-terminal residue | 240 | |||||
Sequence: G |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
MK185837 EMBL· GenBank· DDBJ | QGN05620.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185838 EMBL· GenBank· DDBJ | QGN05621.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185840 EMBL· GenBank· DDBJ | QGN05623.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185844 EMBL· GenBank· DDBJ | QGN05627.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185845 EMBL· GenBank· DDBJ | QGN05628.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185846 EMBL· GenBank· DDBJ | QGN05629.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185847 EMBL· GenBank· DDBJ | QGN05630.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185849 EMBL· GenBank· DDBJ | QGN05632.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185851 EMBL· GenBank· DDBJ | QGN05634.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185852 EMBL· GenBank· DDBJ | QGN05635.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185854 EMBL· GenBank· DDBJ | QGN05637.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185859 EMBL· GenBank· DDBJ | QGN05642.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185861 EMBL· GenBank· DDBJ | QGN05644.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185862 EMBL· GenBank· DDBJ | QGN05645.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185866 EMBL· GenBank· DDBJ | QGN05649.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185871 EMBL· GenBank· DDBJ | QGN05654.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK185872 EMBL· GenBank· DDBJ | QGN05655.1 EMBL· GenBank· DDBJ | Genomic DNA |